KEGG   Ailuropoda melanoleuca (giant panda): 100480483Help
Entry
100480483         CDS       T01329                                 

Definition
mitogen-activated protein kinase 11-like
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Amyotrophic lateral sclerosis (ALS)
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Influenza A
Epstein-Barr virus infection
Proteoglycans in cancer
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100480483
   04010 MAPK signaling pathway
    100480483
   04370 VEGF signaling pathway
    100480483
   04668 TNF signaling pathway
    100480483
   04068 FoxO signaling pathway
    100480483
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    100480483
 Organismal Systems
  Immune system
   04611 Platelet activation
    100480483
   04620 Toll-like receptor signaling pathway
    100480483
   04621 NOD-like receptor signaling pathway
    100480483
   04622 RIG-I-like receptor signaling pathway
    100480483
   04660 T cell receptor signaling pathway
    100480483
   04664 Fc epsilon RI signaling pathway
    100480483
   04670 Leukocyte transendothelial migration
    100480483
  Endocrine system
   04912 GnRH signaling pathway
    100480483
   04914 Progesterone-mediated oocyte maturation
    100480483
   04917 Prolactin signaling pathway
    100480483
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100480483
  Nervous system
   04728 Dopaminergic synapse
    100480483
   04723 Retrograde endocannabinoid signaling
    100480483
   04722 Neurotrophin signaling pathway
    100480483
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100480483
  Development
   04380 Osteoclast differentiation
    100480483
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100480483
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100480483
  Infectious diseases
   05132 Salmonella infection
    100480483
   05133 Pertussis
    100480483
   05152 Tuberculosis
    100480483
   05164 Influenza A
    100480483
   05160 Hepatitis C
    100480483
   05169 Epstein-Barr virus infection
    100480483
   05145 Toxoplasmosis
    100480483
   05140 Leishmaniasis
    100480483
   05142 Chagas disease (American trypanosomiasis)
    100480483
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100480483
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100480483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 328 aa AA seqDB search
MGHSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSI
EDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNV
AVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAEL
LQGKALFPGNDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLRSIFHG
ANPLAVDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTVEE
WKELTYQEVLSFKPAELPQSAGGLDIEQ
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgggccactcggcctatgacgcgcggctgcgccagaaggtggcggtgaagaagctgtcg
cgacccttccagtcgctgatccacgcgcggaggacttaccgcgagctacggctgctcaag
cacctgaagcacgagaacgtcattgggctgctggacgtgttcacgcccgccacctccatc
gaggacttcagcgaagtgtacctggtgaccaccctgatgggcgccgacctgaacaacatc
gtcaagtgccaggcgctgagcgacgagcacgtccagttcctggtttaccagttgcttcgc
gggctgaagtacatccactccgcggggatcatccaccgggacctgaagcccagcaacgtg
gctgtgaacgaggactgcgagcttaggatcctggactttgggctagcccgccaggctgat
gaggagatgaccggctatgtggccactcgctggtaccgggcccccgagatcatgctgaat
tggatgcactacaaccagacagtggacatctggtctgtaggctgcatcatggctgagctg
ctccaaggaaaggccctctttccaggaaatgactacatcgaccagctgaagcgaatcatg
gaagttgtgggcacacccagccctgaggttctagcaaagatatcctcagaacacgcccgg
acatacatccagtccctgccccctatgccccagaaggacctcaggagcatcttccatgga
gccaaccccctggctgtggacctcctgggaaggatgctggtgcttgacagtgaccagagg
gtcagtgcggccgaggccctggcccatgcctacttcagccagtaccacgaccccgaagat
gagcctgaggccgagccctacgatgagagcgttgaggccaaggagcgtacagtggaggag
tggaaggagctcacctaccaggaggtcctcagcttcaagcctgcagagctgccgcagtca
gccggcggcctggacattgagcagtga

DBGET integrated database retrieval system