KEGG   Ailuropoda melanoleuca (giant panda): 100480487Help
Entry
100480487         CDS       T01329                                 

Definition
sperm acrosome-associated protein 5-like
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 161 aa AA seqDB search
MQTWVTVAVTLATLMVAIMDAKIYERCELAMKLERAGLNGFKGYSIGDWLCMAHYESGFD
TSLVDHNPDGSSEYGIFQLSSAWWCNNGVTPTQNLCHMECRDLLNHHILDDILCARQVVS
SENGMTAWDSWTRHCSGHDLSEWLKGCNMHAKPDAKKINNS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcagacctgggtcactgtggcggtgaccctggccacactgatggtcgccatcatggat
gcaaagatctacgaacgctgtgaactggcaatgaagctggaaagagcgggcctcaatggc
ttcaagggctacagcattggagactggctctgcatggcacactatgagagtggctttgac
acctccctcgtggaccacaatcccgacggcagcagtgaatacggcattttccagctgagc
tccgcctggtggtgtaacaatggtgttacacccacccaaaacctctgtcacatggagtgt
cgagacctgctcaaccaccatattctggatgatatcttgtgtgccaggcaggtggtgtcc
tcagagaatggtatgactgcttgggattcatggacccggcactgttctggccacgattta
tctgaatggctcaagggatgtaatatgcatgccaaacctgatgccaagaaaattaataat
tcatga

DBGET integrated database retrieval system