KEGG   Ailuropoda melanoleuca (giant panda): 100480586Help
Entry
100480586         CDS       T01329                                 

Gene name
PLCG1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00562  Inositol phosphate metabolism
aml01100  Metabolic pathways
aml01521  EGFR tyrosine kinase inhibitor resistance
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04064  NF-kappa B signaling pathway
aml04066  HIF-1 signaling pathway
aml04070  Phosphatidylinositol signaling system
aml04072  Phospholipase D signaling pathway
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04670  Leukocyte transendothelial migration
aml04722  Neurotrophin signaling pathway
aml04750  Inflammatory mediator regulation of TRP channels
aml04919  Thyroid hormone signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05167  Kaposi's sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05214  Glioma
aml05223  Non-small cell lung cancer
aml05225  Hepatocellular carcinoma
aml05231  Choline metabolism in cancer
Module
aml_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100480586 (PLCG1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100480586 (PLCG1)
   04015 Rap1 signaling pathway
    100480586 (PLCG1)
   04012 ErbB signaling pathway
    100480586 (PLCG1)
   04370 VEGF signaling pathway
    100480586 (PLCG1)
   04064 NF-kappa B signaling pathway
    100480586 (PLCG1)
   04066 HIF-1 signaling pathway
    100480586 (PLCG1)
   04020 Calcium signaling pathway
    100480586 (PLCG1)
   04070 Phosphatidylinositol signaling system
    100480586 (PLCG1)
   04072 Phospholipase D signaling pathway
    100480586 (PLCG1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100480586 (PLCG1)
   04660 T cell receptor signaling pathway
    100480586 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    100480586 (PLCG1)
   04659 Th17 cell differentiation
    100480586 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    100480586 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    100480586 (PLCG1)
   04670 Leukocyte transendothelial migration
    100480586 (PLCG1)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100480586 (PLCG1)
  Nervous system
   04722 Neurotrophin signaling pathway
    100480586 (PLCG1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100480586 (PLCG1)
  Development
   04360 Axon guidance
    100480586 (PLCG1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100480586 (PLCG1)
   05231 Choline metabolism in cancer
    100480586 (PLCG1)
   05206 MicroRNAs in cancer
    100480586 (PLCG1)
   05205 Proteoglycans in cancer
    100480586 (PLCG1)
   05225 Hepatocellular carcinoma
    100480586 (PLCG1)
   05214 Glioma
    100480586 (PLCG1)
   05223 Non-small cell lung cancer
    100480586 (PLCG1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100480586 (PLCG1)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100480586 (PLCG1)
   05169 Epstein-Barr virus infection
    100480586 (PLCG1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100480586 (PLCG1)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100480586 (PLCG1)
Membrane trafficking [BR:aml04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100480586 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100480586 (PLCG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 PH_12 GDPD
Motif
Other DBs
NCBI-GeneID: 100480586
NCBI-ProteinID: XP_019654464
Ensembl: ENSAMEG00000009575
Position
Un
AA seq 1293 aa AA seqDB search
AGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVXXXXXKLE
TRQITWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFR
LKTLSLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSLDRNREDRISAKD
LKNMLSQVNYRVPNMRFLRERLTDLEQRSSDITYGQFAQLYRSLMYSAQKTMDLPFLEAS
ALRAGERPELCRVSLPEFQQFLLEYQGELWAVDRLQVHEFMLSFLRDPLREIEEPYFSLD
EFVTFLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARC
LRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDH
CSIAQQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVP
TSVMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPK
EASGSTELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYT
LSFWRNGKVQHCRIHSRQDAGAPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEP
VPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCR
VQQEGQTVTLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYE
GRNPGFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGK
KQLWFPSNYVEEMVSPASLEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFV
FSISMASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSEL
VVYCRPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQ
RLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEAFDP
FDKSSLRGLEPYAICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSIKQKTEFVVDNGL
NPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNY
SEDLELASLLVKIDVFPAKENGDLSPFSMSLRERGSDTSGQLFHGRAREGSFEARYQQPF
EDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3882 nt NT seq  +upstreamnt  +downstreamnt
gcgggcgccgcgtccccctgcgccaatggctgcgggcccggcgcgccctcggacgccgag
gtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactccaag
aagtcgcagcggccggagcggaagaccttccaggtcaannnnnnnnnnnncaagctggag
acgcggcagatcacgtggagccgtggcgccgacaagatcgagggggccattgacattcgc
gaaatcaaggagatccgcccagggaagacctcacgggattttgatcgctaccaagaggac
cctgctttccgaccagaccagtcacactgctttgtcatcctgtatgggatggaattccgc
ctgaagaccctgagcctgcaagctacgtctgaggatgaagtgaacatgtggatcaagggt
ttaacatggttgatggaggatacattgcaggcagccacgcctctgcagatcgagaggtgg
ctgcggaagcagttctactcgctggatcggaatcgtgaggatcgtatatcagccaaggac
ctgaagaacatgctgtcccaggtcaactaccgggtccccaacatgcgcttcctccgagag
cgtctgacggacctggagcagcgcagcagtgacatcacctacgggcagtttgctcagctg
taccgcagcctgatgtacagcgcccagaagacgatggacctccccttcttggaagccagt
gccctgagggctggggagcggccggagctctgtcgcgtgtcccttcctgagttccagcag
ttcctcctcgagtaccagggggagctgtgggctgttgaccggcttcaggtgcatgagttc
atgctcagcttccttcgagaccccttgcgagaaattgaagagccatacttctccctggat
gagtttgtcaccttcctgttctccaaagagaacagtgtgtggaactcgcagctggatgca
gtgtgcccggataccatgaacaaccctctctcccactactggatctcttcctcccacaac
acgtacctgaccggggaccagttctccagcgagtcctccctagaagcctacgctcgctgc
ctgcggatgggctgtcgctgcattgagttggactgctgggacggcccagatgggatgcca
gtcatttaccatggacacacccttaccaccaagatcaagttctcggatgttctgcacacc
atcaaggagcatgcctttgtggcctcagagtacccggtcatcctgtccatcgaggaccac
tgcagcattgctcagcagagaaacatggcacagtatttcaagaaggtgcttggggacaca
ctccttaccaagcccgtggacatcgctgccgacgggctcccctcacccaaccagctcaag
aggaagatcctcatcaagcacaagaagctggcggagggcagtgcctacgaagaggtgcct
acgtcggtgatgtactccgagaatgatatcagcaactccatcaagaatggcatcctctac
ctggaggaccccgtgaaccatgagtggtacccccactatttcgttctgaccagcagcaag
atctactactctgaggagaccagcagtgaccagggcaatgaggatgaggaggagcccaag
gaggccagtggcagcacagagctgcactccagtgagaagtggttccatgggaagctcggg
gcgggacgggacggacggcacatcgctgagcgcctgctcaccgagtactgcatcgagacc
ggggcccctgatggctccttcctcgtgcgggagagcgagacctttgtgggcgactacacc
ctctctttctggaggaacgggaaagtccagcactgccggatccactcccggcaggacgct
ggggcccccaagttcttcttgacagacaacttggtctttgactcgctctatgacctcatc
acgcactaccagcaggtgcccctgcgctgcaacgaatttgagatgcgcctctccgagcct
gtcccgcagaccaatgcccacgagagcaaagagtggtaccacgccagcctgaccagagct
caggccgagcacatgctgatgcgtgtcccccgggatggggccttcctggtgagaaaacgg
aatgagcccaactcctacgccatctccttccgggccgagggcaagatcaagcattgccgc
gtccagcaggagggccagacggtgacgctgggcaactcggagttcgacagcctcgtggac
ctcatcagctactatgagaagcacccgctgtaccgcaagatgaagctgcgctaccccatc
aacgaggaggcgctagagaagatcggcaccgctgagcctgactatggagccttgtatgag
ggacgcaaccctggcttctacgtagaggcaaatcctatgccgactttcaagtgtgcggtc
aaagccctctttgactacaaggcccagagggaggacgagctgacgttcacaaagagcgcc
atcatccagaacgtggagaagcaagaaggcggctggtggcggggggactacggggggaag
aagcagctgtggttcccgtcaaactacgtggaggagatggtcagccctgcatccctggag
ccggagagggagcacttggacgagaacagccccctgggggacttgctccggggggtcttg
gatgtgccggcttgtcagattgccatccgtcctgagggcaagaacaaccggctcttcgtc
ttctccatcagcatggcttcagtggcgcactggtccttggacgtcgccgctgactcacag
gaggagctgcaggactgggtgaagaagatccgagaagtggcccagacggcagacgccagg
ctcacagaggggaagatgatggagcgcagaaagaagattgccctagagctctccgagctg
gttgtctactgtcggcctgttcccttcgatgaagagaagattggcacagaacgtgcctgc
taccgggacatgtcgtcctttccggaaaccaaggctgagaaatacgtgaacaaggccaaa
ggcaagaagttcctccagtacaaccgtctgcagctctcccgcatctaccccaagggccag
cggctagactcctccaattacgaccccttgcccatgtggatctgcggcagtcagctggtg
gccctcaacttccagacgccagacaagcctatgcagatgaaccaggcgctcttcatggcc
ggtggccactgcggctacgtgctgcagcccagcaccatgcgggatgaggcctttgaccct
tttgacaagagcagcctccgaggcctagagccatatgccatctgcattgaggtgctgggg
gcccggcacctgccaaagaatggccgaggcatcgtgtgtccttttgtggagattgaggtg
gccggagcggagtatgacagcatcaagcagaagacagagtttgtggtggacaatggactg
aaccctgtgtggcctgccaagcccttccacttccagatcagtaacccggaatttgccttt
ctgcgctttgtggtgtatgaggaagacatgtttagtgaccagaacttcttggctcaggct
accttcccggtgaaaggcctgaagacaggatacagagccgtgcctttgaagaacaactac
agtgaggacttggagctggcctccctgctcgtcaagatcgatgttttccctgccaaggaa
aacggggacctcagtcccttcagtatgtctctgcgggagcggggctccgatacctcaggc
cagctgtttcatggccgggcccgggaaggttcctttgaagcccgctaccagcagccattt
gaggactttcgtatctcccaggagcacctggcagaccattttgacagtcgggaacggagg
gccccacgaaggactcgggtcaacggagacaaccgcctctag

DBGET integrated database retrieval system