KEGG   Ailuropoda melanoleuca (giant panda): 100480586Help
Entry
100480586         CDS       T01329                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1-like
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
Thyroid hormone signaling pathway
Epstein-Barr virus infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100480586
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100480586
   04015 Rap1 signaling pathway
    100480586
   04012 ErbB signaling pathway
    100480586
   04370 VEGF signaling pathway
    100480586
   04064 NF-kappa B signaling pathway
    100480586
   04066 HIF-1 signaling pathway
    100480586
   04020 Calcium signaling pathway
    100480586
   04070 Phosphatidylinositol signaling system
    100480586
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100480586
   04660 T cell receptor signaling pathway
    100480586
   04664 Fc epsilon RI signaling pathway
    100480586
   04666 Fc gamma R-mediated phagocytosis
    100480586
   04670 Leukocyte transendothelial migration
    100480586
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100480586
  Nervous system
   04722 Neurotrophin signaling pathway
    100480586
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100480586
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100480586
   05206 MicroRNAs in cancer
    100480586
   05205 Proteoglycans in cancer
    100480586
   05214 Glioma
    100480586
   05223 Non-small cell lung cancer
    100480586
  Infectious diseases
   05169 Epstein-Barr virus infection
    100480586
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100480586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1296 aa AA seqDB search
XXXAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVXXXXX
KLETRQITWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGM
EFRLKTLSLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSLDRNREDRIS
AKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSSDITYGQFAQLYRSLMYSAQKTMDLPFL
EASALRAGERPELCRVSLPEFQQFLLEYQGELWAVDRLQVHEFMLSFLRDPLREIEEPYF
SLDEFVTFLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAY
ARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSI
EDHCSIAQQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYE
EVPTSVMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEE
EPKEASGSTELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVG
DYTLSFWRNGKVQHCRIHSRQDAGAPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRL
SEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIK
HCRVQQEGQTVTLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGA
LYEGRNPGFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDY
GGKKQLWFPSNYVEEMVSPASLEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNR
LFVFSISMASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALEL
SELVVYCRPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYP
KGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEA
FDPFDKSSLRGLEPYAICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSIKQKTEFVVD
NGLNPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLK
NNYSEDLELASLLVKIDVFPAKENGDLSPFSMSLRERGSDTSGQLFHGRAREGSFEARYQ
QPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3891 nt NT seq  +upstreamnt  +downstreamnt
nnnnnnnnngcgggcgccgcgtccccctgcgccaatggctgcgggcccggcgcgccctcg
gacgccgaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttc
tactccaagaagtcgcagcggccggagcggaagaccttccaggtcaannnnnnnnnnnnc
aagctggagacgcggcagatcacgtggagccgtggcgccgacaagatcgagggggccatt
gacattcgcgaaatcaaggagatccgcccagggaagacctcacgggattttgatcgctac
caagaggaccctgctttccgaccagaccagtcacactgctttgtcatcctgtatgggatg
gaattccgcctgaagaccctgagcctgcaagctacgtctgaggatgaagtgaacatgtgg
atcaagggtttaacatggttgatggaggatacattgcaggcagccacgcctctgcagatc
gagaggtggctgcggaagcagttctactcgctggatcggaatcgtgaggatcgtatatca
gccaaggacctgaagaacatgctgtcccaggtcaactaccgggtccccaacatgcgcttc
ctccgagagcgtctgacggacctggagcagcgcagcagtgacatcacctacgggcagttt
gctcagctgtaccgcagcctgatgtacagcgcccagaagacgatggacctccccttcttg
gaagccagtgccctgagggctggggagcggccggagctctgtcgcgtgtcccttcctgag
ttccagcagttcctcctcgagtaccagggggagctgtgggctgttgaccggcttcaggtg
catgagttcatgctcagcttccttcgagaccccttgcgagaaattgaagagccatacttc
tccctggatgagtttgtcaccttcctgttctccaaagagaacagtgtgtggaactcgcag
ctggatgcagtgtgcccggataccatgaacaaccctctctcccactactggatctcttcc
tcccacaacacgtacctgaccggggaccagttctccagcgagtcctccctagaagcctac
gctcgctgcctgcggatgggctgtcgctgcattgagttggactgctgggacggcccagat
gggatgccagtcatttaccatggacacacccttaccaccaagatcaagttctcggatgtt
ctgcacaccatcaaggagcatgcctttgtggcctcagagtacccggtcatcctgtccatc
gaggaccactgcagcattgctcagcagagaaacatggcacagtatttcaagaaggtgctt
ggggacacactccttaccaagcccgtggacatcgctgccgacgggctcccctcacccaac
cagctcaagaggaagatcctcatcaagcacaagaagctggcggagggcagtgcctacgaa
gaggtgcctacgtcggtgatgtactccgagaatgatatcagcaactccatcaagaatggc
atcctctacctggaggaccccgtgaaccatgagtggtacccccactatttcgttctgacc
agcagcaagatctactactctgaggagaccagcagtgaccagggcaatgaggatgaggag
gagcccaaggaggccagtggcagcacagagctgcactccagtgagaagtggttccatggg
aagctcggggcgggacgggacggacggcacatcgctgagcgcctgctcaccgagtactgc
atcgagaccggggcccctgatggctccttcctcgtgcgggagagcgagacctttgtgggc
gactacaccctctctttctggaggaacgggaaagtccagcactgccggatccactcccgg
caggacgctggggcccccaagttcttcttgacagacaacttggtctttgactcgctctat
gacctcatcacgcactaccagcaggtgcccctgcgctgcaacgaatttgagatgcgcctc
tccgagcctgtcccgcagaccaatgcccacgagagcaaagagtggtaccacgccagcctg
accagagctcaggccgagcacatgctgatgcgtgtcccccgggatggggccttcctggtg
agaaaacggaatgagcccaactcctacgccatctccttccgggccgagggcaagatcaag
cattgccgcgtccagcaggagggccagacggtgacgctgggcaactcggagttcgacagc
ctcgtggacctcatcagctactatgagaagcacccgctgtaccgcaagatgaagctgcgc
taccccatcaacgaggaggcgctagagaagatcggcaccgctgagcctgactatggagcc
ttgtatgagggacgcaaccctggcttctacgtagaggcaaatcctatgccgactttcaag
tgtgcggtcaaagccctctttgactacaaggcccagagggaggacgagctgacgttcaca
aagagcgccatcatccagaacgtggagaagcaagaaggcggctggtggcggggggactac
ggggggaagaagcagctgtggttcccgtcaaactacgtggaggagatggtcagccctgca
tccctggagccggagagggagcacttggacgagaacagccccctgggggacttgctccgg
ggggtcttggatgtgccggcttgtcagattgccatccgtcctgagggcaagaacaaccgg
ctcttcgtcttctccatcagcatggcttcagtggcgcactggtccttggacgtcgccgct
gactcacaggaggagctgcaggactgggtgaagaagatccgagaagtggcccagacggca
gacgccaggctcacagaggggaagatgatggagcgcagaaagaagattgccctagagctc
tccgagctggttgtctactgtcggcctgttcccttcgatgaagagaagattggcacagaa
cgtgcctgctaccgggacatgtcgtcctttccggaaaccaaggctgagaaatacgtgaac
aaggccaaaggcaagaagttcctccagtacaaccgtctgcagctctcccgcatctacccc
aagggccagcggctagactcctccaattacgaccccttgcccatgtggatctgcggcagt
cagctggtggccctcaacttccagacgccagacaagcctatgcagatgaaccaggcgctc
ttcatggccggtggccactgcggctacgtgctgcagcccagcaccatgcgggatgaggcc
tttgacccttttgacaagagcagcctccgaggcctagagccatatgccatctgcattgag
gtgctgggggcccggcacctgccaaagaatggccgaggcatcgtgtgtccttttgtggag
attgaggtggccggagcggagtatgacagcatcaagcagaagacagagtttgtggtggac
aatggactgaaccctgtgtggcctgccaagcccttccacttccagatcagtaacccggaa
tttgcctttctgcgctttgtggtgtatgaggaagacatgtttagtgaccagaacttcttg
gctcaggctaccttcccggtgaaaggcctgaagacaggatacagagccgtgcctttgaag
aacaactacagtgaggacttggagctggcctccctgctcgtcaagatcgatgttttccct
gccaaggaaaacggggacctcagtcccttcagtatgtctctgcgggagcggggctccgat
acctcaggccagctgtttcatggccgggcccgggaaggttcctttgaagcccgctaccag
cagccatttgaggactttcgtatctcccaggagcacctggcagaccattttgacagtcgg
gaacggagggccccacgaaggactcgggtcaacggagacaaccgcctctag

DBGET integrated database retrieval system