KEGG   Ailuropoda melanoleuca (giant panda): 100480599Help
Entry
100480599         CDS       T01329                                 

Gene name
CACNA2D2
Definition
calcium channel, voltage-dependent, alpha 2/delta subunit 2
Orthology
K04859  
voltage-dependent calcium channel alpha-2/delta-2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:aml04010]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:aml04921]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:aml04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:aml04261]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:aml05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:aml05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:aml05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1081 aa AA seqDB search
MSFRMQHWARRLEQEIDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIES
LLDRKVQALKRLADAAENFQKAHRWQDNIKEEDILYYDAKAEAELDDPESEDVERGSKVS
TLRLDFIEDSNFKNKVNYSYTAVQIPTDIYKGSTVILNELNWTEALENVFIENRRQDPTL
LWQVFGSATGVTRYYPATPWRAPKKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSGL
TLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFKEAVQGMVA
KGTTGYKAGFEYAFDQLQNSNITRANCNKVIMMFTDGGEDRVQDVFEKYNWPNRTVRVFT
FSVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKEAKQVQW
TNVYEDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPNYTLGA
NGYVFAIDLNGYVLLHPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMIDGNKGHKQ
IRTLVKSLDERYVDEVVRNYTWVPIRSTNYSLGLVLPPYSTFYLQANLSDQILQVKLPIS
KLKDFEFLLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTPDSKQCNNF
LLHNLILDTGITQQLVERVWRDQDLNTYSLLAVFAATDGGITRVFPNKAAEDWTENPEPF
NASFYRRSLDNHGYVFKPPHQDALLRPLELENDTVGILVSTAVELSLGGRTLRPAVVGVK
LDLEAWAEKFKVLASNRTHQDQPQKCGPSSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQN
HQWDQVGRFFSEVDANLMLALYNNSFYTRKESYDYQAACAPQPPGNLGAAPRGVFVPTIA
DFLNLAWWTSAAAWSLFQQLLYGLIYHSWFQADPAEAEGNPEARESSCVMKQTQYYFGSV
NASYNAIIDCGNCSRCPRGAGRENXXXXXXXXPRPLRALPASLTPHPCPADGPEQCELVQ
RPRYRRHICFDYNATEDTSDCGRGASFPPSLGVLVSLQLLLLLGLPPRPQPQVHAHASRR
V
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaggatgcagcactgggcccggcgcctggagcaggagatcgatggcgtgatg
cggatcttcgggggtgtccagcagctccgtgagatctacaaggataaccggaatctgttt
gaggtgcaggagaacgagcctcagaagttggtggaaaaggtggcaggagacatcgagagc
ctgctggacaggaaggtgcaggccctaaagagactggccgatgctgcagagaacttccag
aaagcccaccgctggcaggacaacatcaaggaggaagatatcctgtactatgatgccaag
gccgaagctgagctggacgaccctgagagtgaggatgtggagagggggtccaaggtcagc
accctcagactggacttcattgaggactcaaacttcaagaacaaagtcaactattcgtac
acagctgtgcagatccccacggacatctacaaaggctccactgtcatcctcaatgaactc
aactggacagaggccctggagaacgtgttcatcgagaaccgcaggcaggaccccacgctg
ctgtggcaggtgtttggaagtgccacaggggtcactcgctactacccagccaccccatgg
cgagcccccaagaaaatcgacctgtacgatgtccgaaggagaccctggtacatccagggg
gcctcgtcgcccaaggacatggtcatcatcgtggatgtgagcggcagcgtgagtggcctg
accctgaagctgatgaagacgtccgtctgtgagatgctggacacgctctcggacgatgac
tatgtgaacgtggcctcgttcaacgaaaaggcgcagcctgtgtcatgcttcacgcacctg
gtgcaggccaatgtgcgcaacaagaaggtgttcaaggaggccgtgcagggcatggtggcc
aagggcaccacaggctacaaggccggctttgagtacgccttcgaccagctgcagaactcc
aacatcacccgcgccaactgcaacaaggtaatcatgatgttcacggacggcggtgaggac
cgcgtgcaggacgtctttgagaagtacaactggcccaaccgcacggtgcgcgtgttcacg
ttctccgtggggcaacacaactacgacgtcacgcccctgcagtggatggcctgcgccaac
aaaggttactattttgagatcccttccattggagccatccgcattaacacgcaggaatat
ttggatgtgttgggcaggcccatggtgctggcgggcaaggaggccaagcaggtgcaatgg
accaacgtgtatgaggatgctctggggctggggttggtggtgacagggaccctccctgtg
ttcaacctgacacaggatggccctggggaaaaaaagaaccagctgatcctgggtgtgatg
ggcatcgatgtggctctgaatgacatcaagaggctgactccaaactacacgcttggagcc
aacggctacgtgtttgccattgacctgaacggctatgtgttgctgcaccccaacctcaag
ccccagaccaccaacttccgggagcctgtgaccctggacttcctggatgctgagctggag
gatgagaacaaggaggagatccgtcgcagcatgatcgatggcaacaagggccacaagcag
atcagaacactggtcaagtccctggacgagaggtacgtagatgaggtggtgcggaactac
acctgggtgcccataaggagcaccaactacagcctagggcttgtgctcccgccctacagc
accttctacctccaagccaacctcagcgaccagatcctgcaggtcaagttgccaatcagc
aaactgaaggattttgagttcctgctccccagcagctttgagtctgaaggacatgttttc
attgctcccagagagtattgcaaggacctgaatgcctcagacaacaacaccgagttcctg
aaaaacttcattgagctcatggagaaagtgactccagactccaagcagtgcaacaacttc
cttctgcacaacctcatcttggacaccggcatcacacagcagctggtggagcgtgtgtgg
cgggaccaggatctcaacacgtacagccttctggccgtgttcgctgccaccgacggtggc
atcactcgagtattccccaacaaagcggctgaggactggacggagaacccggagcccttc
aatgccagcttctaccgccgtagcctggacaatcacggctatgtcttcaaacccccacac
caggatgccctgttaaggccactggagctggagaatgacacggtgggcatcctcgtcagc
acagctgtggagctaagcctgggcggacgcacactgaggccagcagtggtaggtgttaaa
ctggacctagaagcctgggctgagaagttcaaggtgctagccagcaaccgtacccaccag
gaccagcctcagaagtgtggccccagcagccactgtgagatggactgcgaggttaataat
gaggacctgctctgtgtcctcattgacgatgggggattcctggtgctgtcaaaccaaaat
catcagtgggaccaggtgggcaggttcttcagtgaggtggatgccaacctgatgctggca
ctctacaataactctttctacacccgcaaagagtcctacgactatcaggcagcctgcgcc
ccccagcccccgggcaacctgggcgctgcaccccggggcgtctttgtgcccaccattgca
gatttccttaacctggcctggtggacctcggctgcagcctggtccttgttccagcagctt
ctctatggcctcatctatcatagctggttccaggcagaccccgccgaggccgaggggaac
cccgaggcgcgcgagagcagctgcgtcatgaaacagacccagtactacttcgggtcggtg
aacgcctcctacaacgccatcatcgactgtggaaactgctccaggtgcccgcggggagcg
ggacgggagaacnnnnnnnnnnnnnnnnnnnnnnnnccgcgccccctccgtgccctgccc
gcctccttgactccccacccatgcccagcggacggcccggagcaatgtgaactggtgcag
agaccgcgataccggaggcacatctgctttgactacaacgcgacggaagatacctcagac
tgcggccgcggagcgtccttcccgccgtcgctgggcgtcctggtctccctgcagctgctg
ctcctcctgggcttgcctccccggccgcagccccaagtccacgcccacgcctcgcgccgc
gtctga

DBGET integrated database retrieval system