KEGG   Ailuropoda melanoleuca (giant panda): 100480623Help
Entry
100480623         CDS       T01329                                 

Definition
histone deacetylase 8-like
Orthology
K11405  
histone deacetylase 8 [EC:3.5.1.98]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Alcoholism
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:aml05203]
Human Diseases; Substance dependence; Alcoholism [PATH:aml05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 547 aa AA seqDB search
MLTREHRCGRSEEQEPEPGLSPKKAGSRRWLRNGCNWKMEEPEEPADSGQSLPPVYIYSP
EYVSMCDSLAKVPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKV
SQEGDDDHPDSTEYGLGYDCPATEGIFDYAAAVGGATITAAQCLIDGVCKVAINWSGGWH
HAKKDEASGFCYLNDAVLGILRLRRKFDRILYVDLDLHHGDGVEDAFSFTSKVMTVSLHK
FSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYHICESVLKEVYIAFNPKAVVL
QLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLVLGGGGYNLANTARCWTYLTGVI
LGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRVQQILNYIKAITRARACLCNA
EIESKTKKAQQEYVTALVSSPATVMLGRIGDGSSAGRFLMLSVAVEHQGKQATLGPGVHF
FNEYLLGTYHVPGTVEGDNSRVMNKTDNGSALTELVTGYRPNPINTQDVFGVLSALKATK
QDDVTES
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccagggagcaccgctgcggccgttcagaggagcaggaaccggagcccgggttg
agtccgaaaaaagccggatccagacggtggctccggaacggctgcaactggaagatggag
gagccggaggaaccggcggacagtgggcagtcgctgcctccagtttacatctacagtccc
gagtatgtcagcatgtgcgactccctggccaaagtccccaaacgggccagtatggtacat
tctttgatcgaagcgtatgcactgcataagcaaatgaggatagttaagcccaaagtagca
tccatggaggagatggccaccttccacactgacgcgtatctgcagcatctccagaaggtc
agccaagaaggagatgacgatcacccagactccacagaatatgggctaggttatgactgc
ccagccacagaagggatatttgactacgcagcagctgtaggaggggccacgatcacagct
gcccagtgcctgattgacggagtgtgcaaagtagcaattaactggtccggagggtggcat
catgcaaagaaagatgaagcatctggtttttgttatctcaatgatgctgtcctgggaata
ttacgattgcgacggaaatttgaccgtattctctatgtggatttggatctgcaccatgga
gatggtgtagaagatgccttcagtttcacctccaaagtcatgacagtgtccctgcacaaa
ttctccccgggatttttcccaggaacaggtgacgtgtctgatgttggcctagggaaggga
cggtactacagtgtaaatgtgcccattcaggacggcatacaggatgagaagtattaccac
atctgtgaaagtgtactaaaggaagtatacatagcctttaatcccaaagcagtggtctta
cagctgggagctgatacgattgctggggatcccatgtgctcctttaacatgactccagta
ggaattggcaaatgtcttaagtacatccttcagtggcaattggcaacactcgttttggga
ggaggaggctataaccttgccaacacggctcgatgctggacatacttgaccggggtcatc
ctagggaaaacactatcctctgagatcccagatcatgagtttttcacagcatatggtcct
gattatgtgttggaaatcacgccaagctgccggccagaccgcaatgagccccaccgagtc
cagcaaatcctcaactacatcaaagccatcacacgcgcacgcgcatgcctgtgcaacgct
gaaatcgaatccaaaaccaagaaggcccagcaagagtatgtcaccgctttggtttccagc
ccggccaccgtgatgctgggcaggatcggggacggaagctcggctgggagatttctcatg
ctgagtgtagcagtagagcaccaggggaagcaagctacgctggggccaggtgtccatttc
ttcaatgaatacttattgggcacctatcatgtgccagggactgttgagggtgataacagt
agagtgatgaacaagacagacaatggttctgccctcacagagctcgtgacgggatacaga
cccaatcccatcaacacacaagatgtattcggtgtgctgagtgcattgaaggcaacaaaa
caggatgatgtgacagaaagttag

DBGET integrated database retrieval system