KEGG   Ailuropoda melanoleuca (giant panda): 100480690Help
Entry
100480690         CDS       T01329                                 

Definition
transcription factor 7-like 1-like
Orthology
K04490  
transcription factor 7-like 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Wnt signaling pathway
Hippo signaling pathway
Adherens junction
Melanogenesis
Pathways in cancer
Colorectal cancer
Endometrial cancer
Prostate cancer
Thyroid cancer
Basal cell carcinoma
Acute myeloid leukemia
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100480690
   04390 Hippo signaling pathway
    100480690
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    100480690
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100480690
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100480690
   05210 Colorectal cancer
    100480690
   05216 Thyroid cancer
    100480690
   05221 Acute myeloid leukemia
    100480690
   05217 Basal cell carcinoma
    100480690
   05215 Prostate cancer
    100480690
   05213 Endometrial cancer
    100480690
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100480690
Transcription factors [BR:aml03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100480690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 779 aa AA seqDB search
MRPLGSRRQLASLHSTAARCPGHLLSGPPARRHPVGLRTQGADVLLTLLWPPVYVPSCRN
PWVLSVGKSQVGGSVAAGPAAAATVLTVPLATTLRTTSSLTDLVRNYGAKVIFGISAAGD
FRHLNKVKNLGEGGGALEPHRKEECKAARHIPGCHKFVRSSLSYASREGEKAGGIPCSEE
LQAASVRGRVCVSEAFPQGAVPPASAPLRWEGVWKRXXXXXXXXGANDELIPFQDEGGEE
QEPSSDSASAQRDLDEVKSSLVNESENQSSSSDSEAERPQPARDAFQKPRDYFTEVRRPQ
DGAFFKGPPYPGYPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRS
PSPAHLSNKVPVVQPPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSE
LSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFS
PHMVAPAHPGLPASGIPHPAIVSPIVKQEPAPPSLSPAVSAKSPVTVKKEEEKKPHVKKP
LNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQL
YPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKSCDSPA
SSHGSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPESRAQLALHSAAFLSAKATA
TSSGQMGSQPPLLSRPLPLGSLPTALLTSPPSFPAALHAHQALPVLQAQPLSLVTKSAH
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgaggccgctgggctccaggcgacagctggcgtctctgcacagcacggcggctcgctgc
ccgggccatctgctctcgggacccccagctcggcgtcatcctgtgggactccggacacag
ggagctgatgtcctgctgactttgctttggccgcctgtgtacgtaccatcctgtcggaac
ccgtgggtgctcagcgtggggaagagccaggtcgggggaagcgtggccgccggcccagcc
gcagcagcgacagtcctcacggtcccgctggccaccacactgcggactacgagttcgttg
actgacctggtccggaactacggggcaaaggtgatctttgggatttcagcggcgggtgac
tttagacacctgaacaaggtcaaaaacctgggcgagggaggaggcgcgttggaaccccac
aggaaggaggagtgcaaggccgcccggcatattccagggtgccataaatttgtccgatcc
tctctgtcctacgcatcccgcgagggagagaaggctggcgggatcccgtgctccgaggaa
ctccaggcagcgagtgtccgcggccgggtctgtgtgtccgaagctttcccgcagggggca
gtgccgcccgccagcgcgccgctgcggtgggagggggtgtggaagcgnnnnnnnnnnnnn
nnnnnnnnnnncggggcgaacgacgaactgatccctttccaagacgaggggggcgaggag
caggagccgagcagcgacagtgcctccgcgcagcgggacctggacgaggtcaagtcgtcc
ctggtcaacgagtcggagaaccaaagcagcagctcggactcggaggcggagcgcccgcag
cccgcccgggacgccttccagaagccgcgggactatttcaccgaagtgagaaggccccag
gacggcgcgttctttaagggccccccgtaccctgggtacccgttcctgatgatcccggac
ttgagcagtccgtacctctccaacggacccttgtctcccggaggagcgcgcacgtacctg
cagatgaaatggcccctcctcgatgtcccctctagcgccacagtcaaggacaccaggtca
ccgtccccagcacacttgtctaataaagttcctgttgttcagcccccgcatcacatgcac
ccgttgacgcccctcatcacctacagcaacgaccacttctcccctggctcccctcccacg
cacctctccccagagatcgatccaaagacaggaatcccccggccccctcacccatctgag
ctgtctccgtattacccactgtctcctggagctgtcggacaaatcccccatcccctcggc
tggctcgtcccacagcaaggacagcccatgtactccctccctcctggtggtttccggcac
ccctaccctgccctcgccatgaacgcctcaatgtccagcctggtttccagtcggttctct
cctcacatggtggctccggcccatcctggtctgcccgcctcagggattccccaccccgcc
attgtctcccccatcgtcaagcaggagccagcgccccccagcctcagcccggccgtgagc
gcgaaatcaccagtcacggtgaaaaaggaggaagaaaagaaaccccacgtgaagaagcct
ctgaatgccttcatgttgtatatgaaggagatgagggccaaggtggtagccgagtgcacc
ctgaaggaaagcgcggccattaaccaaatcctggggagaaagtggcacaacctgtcccga
gaagaacaggccaagtactatgaactggcccggaaggagcggcagctgcattcccagctc
tacccgacctggtcagcccgggacaactatggtaagaaaaagaagaggaagagagaaaag
cagctgtcacagacacagtcccagcagcaagtccaagaggcagagggtgctctggcctcc
aaaagcaagaagccatgtgttcagtacctgccccctgagaagtcctgtgacagccctgcc
tcttcccacggcagcatgctggactccccggccaccccctccgcagccttggcgtccccg
gctgcccccgcggcgacccactcggagcaagcccagcccctctccctcaccaccaagccg
gagagccgggcccagctggctttacactcggctgccttcctgtcggccaaggcgacagcc
acctcctctggccagatgggcagccagcccccgctcctctcccggccactccccctcggg
tccctgcccacagctctgctgacttctcccccctccttcccggccgcgctccatgcccac
caggccctcccagtcctccaggcccagcctctttccttggtcaccaagtctgcccactga

DBGET integrated database retrieval system