KEGG   Ailuropoda melanoleuca (giant panda): 100480698Help
Entry
100480698         CDS       T01329                                 

Definition
glutathione S-transferase theta-1-like
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:aml00480]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:aml00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:aml00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:aml05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 242 aa AA seqDB search
MPLELFLDLYSPPCRAIYIFAMKNGIPFELRSVELGRGEHLKPEFLKVNPLGKVPALKDG
DFLLAESVAILLYLSRKYHAAAHWYPPELQACARVDEYLAWQHTAVQLPATNIYLCKSLL
PYFSEQSVDPVCLDRLLGKLKPALQHLDQEVLAAKPFLATEELSLADLMEFTELMQPTAV
GCDVFQDWPRLAAWQARVEAALGPELVRDAHRLVLQPRDPRDAQRDPKLAQELVQRLLER
LS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggagctgtttctggacctgtactcgcccccctgccgtgccatctacattttt
gccatgaagaatggcattccctttgagctgcggtctgtggagctaggacggggggagcac
ctgaagcctgaattcctgaaagtgaaccccctggggaaggtacctgccctcaaagatggg
gacttcctgctggcagagagcgtggccatccttttatacttgagccgcaagtaccacgcg
gcggcccactggtacccgcccgagctgcaggcctgcgcgcgtgtggacgagtacctggcg
tggcagcacaccgccgtccagctgcctgctaccaacatctacctatgtaagtccctcctg
ccctatttctcggagcagtccgtggaccccgtgtgcctagatcggctgttggggaagctg
aaaccagctctgcagcacctggatcaggaggtcctggccgccaagcccttcctggccact
gaggagctctccctggcagatctgatggaattcacggagctgatgcagcccactgctgtt
ggctgcgatgtcttccaagactggccccggctggcagcatggcaagcccgagtggaggct
gctctgggccctgagctcgtccgggatgcccacaggcttgtgctacagcctcgggacccc
cgggacgcccagcgggaccccaagctggcccaggagctggtgcagagactgctggagcgg
ctcagctga

DBGET integrated database retrieval system