KEGG   Ailuropoda melanoleuca (giant panda): 100480698Help
Entry
100480698         CDS       T01329                                 

Definition
(RefSeq) glutathione S-transferase theta-1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100480698
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100480698
   00982 Drug metabolism - cytochrome P450
    100480698
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100480698
   05204 Chemical carcinogenesis
    100480698
   05225 Hepatocellular carcinoma
    100480698
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100480698
  Drug resistance
   01524 Platinum drug resistance
    100480698
Enzymes [BR:aml01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100480698
Transporters [BR:aml02000]
 Other Transporters
  Pores ion channels [TC:1]
   100480698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 242 aa AA seqDB search
MPLELFLDLYSPPCRAIYIFAMKNGIPFELRSVELGRGEHLKPEFLKVNPLGKVPALKDG
DFLLAESVAILLYLSRKYHAAAHWYPPELQACARVDEYLAWQHTAVQLPATNIYLCKSLL
PYFSEQSVDPVCLDRLLGKLKPALQHLDQEVLAAKPFLATEELSLADLMEFTELMQPTAV
GCDVFQDWPRLAAWQARVEAALGPELVRDAHRLVLQPRDPRDAQRDPKLAQELVQRLLER
LS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggagctgtttctggacctgtactcgcccccctgccgtgccatctacattttt
gccatgaagaatggcattccctttgagctgcggtctgtggagctaggacggggggagcac
ctgaagcctgaattcctgaaagtgaaccccctggggaaggtacctgccctcaaagatggg
gacttcctgctggcagagagcgtggccatccttttatacttgagccgcaagtaccacgcg
gcggcccactggtacccgcccgagctgcaggcctgcgcgcgtgtggacgagtacctggcg
tggcagcacaccgccgtccagctgcctgctaccaacatctacctatgtaagtccctcctg
ccctatttctcggagcagtccgtggaccccgtgtgcctagatcggctgttggggaagctg
aaaccagctctgcagcacctggatcaggaggtcctggccgccaagcccttcctggccact
gaggagctctccctggcagatctgatggaattcacggagctgatgcagcccactgctgtt
ggctgcgatgtcttccaagactggccccggctggcagcatggcaagcccgagtggaggct
gctctgggccctgagctcgtccgggatgcccacaggcttgtgctacagcctcgggacccc
cgggacgcccagcgggaccccaagctggcccaggagctggtgcagagactgctggagcgg
ctcagctga

DBGET integrated database retrieval system