KEGG   Ailuropoda melanoleuca (giant panda): 100480698Help
Entry
100480698         CDS       T01329                                 

Definition
(RefSeq) glutathione S-transferase theta-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00480  Glutathione metabolism
aml00980  Metabolism of xenobiotics by cytochrome P450
aml00982  Drug metabolism - cytochrome P450
aml00983  Drug metabolism - other enzymes
aml01524  Platinum drug resistance
aml05200  Pathways in cancer
aml05204  Chemical carcinogenesis
aml05225  Hepatocellular carcinoma
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100480698
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100480698
   00982 Drug metabolism - cytochrome P450
    100480698
   00983 Drug metabolism - other enzymes
    100480698
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100480698
   05204 Chemical carcinogenesis
    100480698
   05225 Hepatocellular carcinoma
    100480698
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100480698
  Drug resistance
   01524 Platinum drug resistance
    100480698
Enzymes [BR:aml01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100480698
Transporters [BR:aml02000]
 Other Transporters
  Pores ion channels [TC:1]
   100480698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 100480698
NCBI-ProteinID: XP_002925112
Ensembl: ENSAMEG00000013784
UniProt: D2HRC7
Position
Un
AA seq 242 aa AA seqDB search
MPLELFLDLYSPPCRAIYIFAMKNGIPFELRSVELGRGEHLKPEFLKVNPLGKVPALKDG
DFLLAESVAILLYLSRKYHAAAHWYPPELQACARVDEYLAWQHTAVQLPATNIYLCKSLL
PYFSEQSVDPVCLDRLLGKLKPALQHLDQEVLAAKPFLATEELSLADLMEFTELMQPTAV
GCDVFQDWPRLAAWQARVEAALGPELVRDAHRLVLQPRDPRDAQRDPKLAQELVQRLLER
LS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggagctgtttctggacctgtactcgcccccctgccgtgccatctacattttt
gccatgaagaatggcattccctttgagctgcggtctgtggagctaggacggggggagcac
ctgaagcctgaattcctgaaagtgaaccccctggggaaggtacctgccctcaaagatggg
gacttcctgctggcagagagcgtggccatccttttatacttgagccgcaagtaccacgcg
gcggcccactggtacccgcccgagctgcaggcctgcgcgcgtgtggacgagtacctggcg
tggcagcacaccgccgtccagctgcctgctaccaacatctacctatgtaagtccctcctg
ccctatttctcggagcagtccgtggaccccgtgtgcctagatcggctgttggggaagctg
aaaccagctctgcagcacctggatcaggaggtcctggccgccaagcccttcctggccact
gaggagctctccctggcagatctgatggaattcacggagctgatgcagcccactgctgtt
ggctgcgatgtcttccaagactggccccggctggcagcatggcaagcccgagtggaggct
gctctgggccctgagctcgtccgggatgcccacaggcttgtgctacagcctcgggacccc
cgggacgcccagcgggaccccaagctggcccaggagctggtgcagagactgctggagcgg
ctcagctga

DBGET integrated database retrieval system