KEGG   Ailuropoda melanoleuca (giant panda): 100480764Help
Entry
100480764         CDS       T01329                                 

Definition
aldose 1-epimerase-like
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aml00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aml00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 342 aa AA seqDB search
MASVTRAVFGDLPSGAGTVEKFQLQSDLLKVDIISWGCTITALEVKDRQGRASDVVLGFA
ELEGYLQKQPYFGAVVGRVANRIAKGTFTLDGKEHKLAINNGPNSLHGGVRGFDKVLWTP
QVLSDGVQFSRVSPDGEEGYPGELKVWVTYTLDGGELMINYRAQASQTTPVSLTNHSYFN
LAGQGSPNIYDHEVTIEADAFLPVDETLIPTGEVAPVQGTAFDLRKPVKLGKHLQEFHIN
GFDHNFCLKGSKEKRFCARVRHAGSGRVLEVYSTQPGVQFYTGNFLDGTLRGKKGAVYPK
HSGFCLETQNWPDAVNQPHFPPVLLRPGEEYDHTTWFKFSVA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggtgaccagagccgtatttggagacctgccttcaggggcagggacagtggag
aagttccagctgcagtcagacctgctgaaagtggacatcatctcctggggctgcaccatt
acggccctggaggtcaaagacaggcagggcagggcgtccgatgtggtgctcggctttgca
gagttggaaggctacctccaaaagcagccctactttggagccgtggttggcagggtggcc
aaccgaattgccaaaggaacattcacattggacgggaaggagcataagctggccattaac
aatgggcccaacagtctgcatggaggagtcagagggtttgataaggtcctctggacccct
caggtgctgtcagatggcgttcagttctcgagggtcagtccagatggtgaggaaggttac
cctggagagttgaaagtctgggtgacttacacgctggatggtggggagcttatgatcaac
taccgagcccaggccagtcagaccacaccggtcagtctgaccaaccattcctatttcaac
ctggcgggccagggttccccaaacatatatgaccatgaagtcactatagaagctgatgcc
tttttgcctgtggatgaaacgctgattcctacaggagaagttgctccagtgcaaggaact
gcctttgacctgaggaagccagtgaagcttggaaaacacctgcaggagttccatatcaat
ggctttgaccacaatttctgtctgaagggatctaaagagaaacgcttttgtgcacgggtc
cgtcatgctgggagcgggcgggtcctggaagtgtacagcacccagccgggggtccagttt
tacacaggcaacttcctggatggcacactgaggggcaagaagggagcagtctatcccaag
cactctggtttctgcctggagacccagaactggcctgatgccgtcaatcagccccacttc
cctcctgtgctgctgaggcccggggaggagtatgaccacaccacttggttcaagttttct
gtggcttaa

DBGET integrated database retrieval system