KEGG   Ailuropoda melanoleuca (giant panda): 100480951Help
Entry
100480951         CDS       T01329                                 

Gene name
MYL10
Definition
(RefSeq) myosin, light chain 10, regulatory
  KO
K12756  
myosin regulatory light chain 10
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:aml00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100480951 (MYL10)
  Cellular commiunity
   04510 Focal adhesion
    100480951 (MYL10)
   04530 Tight junction
    100480951 (MYL10)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100480951 (MYL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 180 aa AA seqDB search
MTGGFCSTPPGTSQAPRRARKRAEGGASSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDK
EDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVF
DTEGKGFVKADFIKEKLMTQADRFSEDEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgacagggggcttctgcagtaccccacctggcacttcccaggcccccagaagagcccgc
aagagagcagaaggtggcgccagctccaatgtcttctccatgttcgatcagtcccagatc
caggagtttaaagaggccttcaccatcatggaccagaaccgggatggcttcatcgacaag
gaggacctgcgggacacctttgctgccttgggccgcatcaatgtgaagaacgaggagctg
gaggccatggtgaaggaggcccctgggcccatcaacttcaccgtcttcctgaccatgttt
ggggagaagctgaagggtacagacccggaggagaccattctccatgccttcaaagtcttt
gacaccgaagggaaaggttttgtcaaggctgatttcatcaaagagaagctcatgacccag
gcagaccggttcagcgaggacgaggtcaagcagatgtttgcggctttcccgccagacgtg
tgtggcaacctggattaccggaacctatgctacgtcatcacgcacggagaagagaaggat
tag

DBGET integrated database retrieval system