KEGG   Ailuropoda melanoleuca (giant panda): 100480951Help
Entry
100480951         CDS       T01329                                 

Definition
myosin regulatory light chain 10-like
Orthology
K12756  
myosin regulatory light chain 10
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:aml00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100480951
  Cellular commiunity
   04510 Focal adhesion
    100480951
   04530 Tight junction
    100480951
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100480951
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 167 aa AA seqDB search
MAPRRARKRAEGGASSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRI
NVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADFI
KEKLMTQADRFSEDEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcccccagaagagcccgcaagagagcagaaggtggcgccagctccaatgtcttctcc
atgttcgatcagtcccagatccaggagtttaaagaggccttcaccatcatggaccagaac
cgggatggcttcatcgacaaggaggacctgcgggacacctttgctgccttgggccgcatc
aatgtgaagaacgaggagctggaggccatggtgaaggaggcccctgggcccatcaacttc
accgtcttcctgaccatgtttggggagaagctgaagggtacagacccggaggagaccatt
ctccatgccttcaaagtctttgacaccgaagggaaaggttttgtcaaggctgatttcatc
aaagagaagctcatgacccaggcagaccggttcagcgaggacgaggtcaagcagatgttt
gcggctttcccgccagacgtgtgtggcaacctggattaccggaacctatgctacgtcatc
acgcacggagaagagaaggattag

DBGET integrated database retrieval system