KEGG   Ailuropoda melanoleuca (giant panda): 100480951Help
Entry
100480951         CDS       T01329                                 

Definition
myosin regulatory light chain 10-like
Orthology
K12756  
myosin regulatory light chain 10
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:aml04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:aml04510]
Cellular Processes; Cell communication; Tight junction [PATH:aml04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:aml04670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 167 aa AA seqDB search
MAPRRARKRAEGGASSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRI
NVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADFI
KEKLMTQADRFSEDEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcccccagaagagcccgcaagagagcagaaggtggcgccagctccaatgtcttctcc
atgttcgatcagtcccagatccaggagtttaaagaggccttcaccatcatggaccagaac
cgggatggcttcatcgacaaggaggacctgcgggacacctttgctgccttgggccgcatc
aatgtgaagaacgaggagctggaggccatggtgaaggaggcccctgggcccatcaacttc
accgtcttcctgaccatgtttggggagaagctgaagggtacagacccggaggagaccatt
ctccatgccttcaaagtctttgacaccgaagggaaaggttttgtcaaggctgatttcatc
aaagagaagctcatgacccaggcagaccggttcagcgaggacgaggtcaagcagatgttt
gcggctttcccgccagacgtgtgtggcaacctggattaccggaacctatgctacgtcatc
acgcacggagaagagaaggattag

DBGET integrated database retrieval system