KEGG   Ailuropoda melanoleuca (giant panda): 100481026Help
Entry
100481026         CDS       T01329                                 

Gene name
THBS2
Definition
(RefSeq) thrombospondin 2
  KO
K04659  thrombospondin 2/3/4/5
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04145  Phagosome
aml04151  PI3K-Akt signaling pathway
aml04510  Focal adhesion
aml04512  ECM-receptor interaction
aml05144  Malaria
aml05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100481026 (THBS2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100481026 (THBS2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100481026 (THBS2)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100481026 (THBS2)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    100481026 (THBS2)
   05144 Malaria
    100481026 (THBS2)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100481026 (THBS2)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100481026 (THBS2)
  Exosomal proteins of colorectal cancer cells
   100481026 (THBS2)
  Exosomal proteins of bladder cancer cells
   100481026 (THBS2)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100481026 (THBS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 TSP_1 VWC EGF_3 EGF_CA EGF Laminin_G_3 cEGF Laminin_G_2
Motif
Other DBs
NCBI-GeneID: 100481026
NCBI-ProteinID: XP_002926534
Ensembl: ENSAMEG00000004995
Position
Un
AA seq 1172 aa AA seqDB search
MFWALMLLALWASSGARAGGQDEDTAFDLFSISNINRKTIGAKQFRGPDPSVPAYRFVRF
DYIPPVNADYLSKIAKTVRQREGFFLTASLKQDPKSRGTLLALEGPGASQRQFEIVSNGP
ADTLDLTYWIDGTQHVISLEDVGLADSQWKNVTVQVTGDTYSLYVGCDLIDSFTLDEPFY
EQLRTEKSRMYVAKGSARESHFRGLLQNVYLVFENSVEDVLSKKGCQQSQGAEANAISET
TETLHLSPQVAPEYAGPGAPRRPEVCERSCEELGTMITELSGLHVMVNQLHENLRKVSND
NQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTKCTCKKFKTVCHQITCPPATC
ANPSFVEGECCPSCFHSLDGEEGWSPWAEWTQCSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRVCSLGKCDNRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCRGSG
RETKGCQGVPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQHGGKDCVGDVQEQ
QMCNKRSCPIDGCLSNPCFPGAQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECAVVTDV
CFTTSKAHRCVNTNPGFHCLPCPPRYKGTQPFGVGLEAARTEKQVCEPENPCKDKTHACH
KHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNKNLVCATNATYHCIQDNC
PLLPNSGQEDFDKDGTGDACDDDDDNDGVDDEKDNCQLLFNPRQFDYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
VHNPDQTDVDNDLVGDQCDNNEDIDEDGHQNNQDNCPYISNANQADHDHDGQGDACDSDD
DNDGVPDDRDNCRLVSNPGQEDSDGDGRGDACKDDFDNDSIPDIDDVCPENSAISETDFR
NFQMVHLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLTHRPKSGYIRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECRDV
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atgttctgggcgctaatgctgcttgcgctctgggcctcgtccggcgctcgagccggtggc
caggatgaggacacggccttcgaccttttcagcatcagcaacataaaccggaagaccatc
ggggccaagcagttccgggggcctgaccccagcgtgcctgcctatcgcttcgtccgcttt
gactacatcccgccggtgaacgcagattacctcagcaagatcgccaagaccgtgcggcaa
agggagggcttctttctcacggccagcctcaagcaggaccccaagtcccggggcacgctc
ctggctctggagggccccggagcctcccagaggcaattcgaaatcgtctccaacggccca
gcagacacgctggaccttacctactggatagacggcacccagcacgtcatctccctggag
gacgtgggcctggctgactcccagtggaagaacgtgaccgtgcaggtcaccggggacacc
tacagcttgtatgtgggctgtgacctcatcgacagcttcacactggacgagcctttctac
gagcagctgcggacagaaaagagcaggatgtatgtggccaagggctctgcgcgagaaagt
cacttcaggggtttgctgcagaatgtctacttagtgtttgaaaattcagtggaagatgtt
ctgagcaagaaaggttgtcagcaaagtcagggagctgaagccaacgccatcagcgagacc
acagagacgctgcacctgagcccgcaggtggcgcccgagtacgcgggcccgggcgcgccc
aggaggccggaggtgtgtgaacgctcctgtgaggagctgggcaccatgatcaccgagctg
tcggggctgcacgtcatggtcaaccagctgcatgagaacctgcggaaagtgtccaacgat
aaccagtttctctgggagctcatcggcggcccgcccaagacgaggaacatgtccgcttgc
tggcaggacggccgcttcttcgcggaaaatgagacgtgggtggtggacagctgcaccaag
tgtacctgcaagaaatttaaaaccgtttgccaccaaatcacctgtcccccggcgacctgc
gccaacccgtcctttgtggaaggagagtgctgcccgtcctgcttccactcgctggacggc
gaggaaggatggtccccgtgggcggagtggacccagtgctctgtcacctgtggctcgggc
acccagcagagagggcggtcctgtgacgtcaccagcaacacctgcttggggccatccatc
cagacgcgggtgtgcagcctgggcaagtgtgacaaccgcatccggcaggacgggggctgg
agccactggtcgccttggtcgtcctgctctgtgacctgcggcgtcggcaacatcacgcgc
atccgtctttgcaactcgccggtcccccagatgggcggcaagaactgcagagggagcggc
cgcgagacgaagggctgccagggcgtcccatgtccgatcgatggccggtggagcccgtgg
tccccgtggtcagcctgcaccgtcacctgtgccggcgggatccgggagcggacgcgtgtc
tgcaacagccccgagccccagcacgggggcaaggactgcgtgggggacgtccaggagcag
cagatgtgcaataagagaagctgtcccatcgacggctgcttatccaatccctgcttcccc
ggagcccagtgcagcagcttccccgacggctcctggtcctgcggctcctgccccgtgggc
ttcctgggcaacgggacgcactgtgaggacctggatgagtgcgctgtggtcactgacgtc
tgcttcaccacgagcaaagcccaccgctgcgtcaacactaaccccggcttccactgcctg
ccatgcccccctcgctacaaagggacccagccgttcggcgtcggcctggaggccgccagg
accgagaagcaggtgtgtgagcctgaaaacccgtgcaaggacaagactcacgcctgccac
aagcacgcggaatgcatctacctggggcacttcagcgaccccatgtacaagtgtgagtgt
cagaccggctacgcgggcgatgggctcatctgcggggaggactcagacctggacggctgg
cccaacaagaacctggtctgtgccaccaacgccacgtaccactgcatccaggacaactgc
cccctactgcccaattctgggcaggaagacttcgacaaggacggcactggcgatgcctgt
gacgatgacgacgacaatgacggcgtggacgatgagaaggacaactgccagcttctcttt
aacccccgccaattcgactacgacaaggatgaggttggggaccgctgtgacaactgcccg
tatgtgcacaaccctgcacagatcgatacggacaacaacggcgagggggacgcgtgctcc
gtggacatcgatggagacgatgtcttcaacgaacgggacaactgtccctacgtctacaac
actgaccagagagacaccgacggggacggtgtgggcgatcactgcgacaactgccccctg
gtgcacaaccccgaccagactgacgtggacaatgacctcgtgggagaccagtgtgacaac
aatgaggacatcgatgaggacggtcaccagaacaaccaggacaactgtccctacatctcc
aacgccaaccaggccgaccatgaccatgacggccagggtgatgcctgtgactcagatgat
gacaacgatggggtccccgacgacagggacaactgccgactggtgtccaacccaggccag
gaggactcggacggtgacggacgtggggacgcttgcaaggatgactttgacaatgacagc
atcccagacattgatgacgtatgtcctgaaaatagcgccatcagtgaaaccgacttcagg
aacttccagatggtccacctggaccccaagggcactactcaaatcgaccccaactgggtc
attcgccatcaaggcaaggaactggtgcagacggccaactcggaccccggcatcgctgtc
ggttttgatgagtttgggtctgtcgacttcagcggcaccttttacgtcaacaccgaccgc
gacgatgactacgccggcttcgtctttggctaccagtccagcagccgcttctacgtggtg
atgtggaagcaggtgacgcagacctactgggaggaccagcccacccgggcctacggctac
tccggcgtgtccctcaaggtggtgaactccaccacgggcaccggcgagcacctgaggaac
gccctgtggcacactgggaacaccgaagggcaggtgcgtacgctgtggcatgaccccaaa
aacatcggctggaaagactacacggcttaccggtggcatctaacccacaggcccaagagc
ggctacataagagtcttagtgcatgagggaaagcaggtcatggcggactcaggacccatc
tacgaccaaacctacgctggcgggcggctgggtctgtttgtcttctctcaagaaatggtc
tatttctcggacctcaaatacgaatgcagagacgtctaa

DBGET integrated database retrieval system