KEGG   Ailuropoda melanoleuca (giant panda): 100481066Help
Entry
100481066         CDS       T01329                                 

Gene name
ST6GAL1
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100481066 (ST6GAL1)
   00514 Other types of O-glycan biosynthesis
    100481066 (ST6GAL1)
Enzymes [BR:aml01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     100481066 (ST6GAL1)
Glycosyltransferases [BR:aml01003]
 Terminal extension
  Sialyltransferase
   100481066 (ST6GAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 399 aa AA seqDB search
MIHTNLKKKFSCCALAFLLFAVICVWKEKKKGSYYDSLKLQTKEFQLLRGLEKQAATSSS
TQKPPRGNQALSSPRGPAKAKPEASFQVWNKDSSSKNLIPRLQKIWRNYLNMNKYKVSYK
GPGPGVKFSAEALHCHLRDHVNVSMVEATDFPFNTSEWEGFLPKENIRTKAGPWGRCAVV
SSAGSLKSSQLGREIDDHDAVLRFNGAPTASFQQDVGTKTTIRLMNSQLVTTEGRFLKDS
LYNEGILIVWDPSVYHSDIPKWYQSPDYSFFENYKSYRKLHPDQPFYILKPQMPWELWDI
IQEVSPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMG
AYHPLLFEKNLVKHLNQGTDEDIYLLGKATLPGFRKIRC
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgattcacaccaacctgaagaaaaagttcagctgctgtgcgctggcctttctcctgttt
gcagtcatctgtgtgtggaaggagaagaagaaaggcagttactatgattcccttaagttg
caaaccaaggaattccagctgttgagaggtctggagaaacaggctgcgacttcaagcagc
acccagaagccccccaggggcaaccaggcgctcagcagtccccggggcccagccaaagcc
aagccagaggcctccttccaggtgtggaacaaggacagctcttccaagaacctcatcccc
aggctgcagaagatctggaggaattatctgaatatgaacaagtacaaagtgtcctataag
gggccagggccgggtgtcaagttcagcgcagaggccctgcactgtcacctccgggaccac
gtgaacgtctccatggtggaggccacagattttcccttcaacacgtccgaatgggagggt
ttcctgcccaaggagaacatcaggaccaaggctgggccatggggcaggtgtgctgttgtc
tcatcggccggatcactgaagtcctcccagctgggccgagaaatagatgatcatgacgca
gtcctgaggtttaatggggcacccacagccagtttccaacaagatgtgggcacgaaaacc
accattcgcctgatgaactctcagctggtcaccactgaagggcgcttcctcaaagacagt
ctgtacaacgagggaatcctgattgtgtgggacccgtctgtttaccattcagatatccca
aagtggtaccagagccctgactatagcttcttcgagaactataaaagctaccgcaagctg
catccagaccagcccttttacatcctcaagccccagatgccttgggagctgtgggacatc
attcaagaagtctccccagaggagattcagcccaaccccccatcctctgggatgcttggt
atcatcatcatgatgacactatgtgaccaggtggatatttacgagttcctcccgtccaag
cgcaagaccgacgtgtgctactactaccagaagttcttcgacagcgcctgcacgatgggc
gcctaccacccgctcctctttgagaagaatctggtgaagcacctcaaccagggcacagac
gaggacatttacctgctggggaaagctacactgcctggcttccggaaaattcgctgctga

DBGET integrated database retrieval system