KEGG   Ailuropoda melanoleuca (giant panda): 100481236Help
Entry
100481236         CDS       T01329                                 

Definition
cell division protein kinase 4-like
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Tight junction
T cell receptor signaling pathway
Hepatitis B
Measles
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Glioma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100481236
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100481236
   04115 p53 signaling pathway
    100481236
  Cellular commiunity
   04530 Tight junction
    100481236
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    100481236
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100481236
   05203 Viral carcinogenesis
    100481236
   05212 Pancreatic cancer
    100481236
   05214 Glioma
    100481236
   05220 Chronic myeloid leukemia
    100481236
   05218 Melanoma
    100481236
   05219 Bladder cancer
    100481236
   05222 Small cell lung cancer
    100481236
   05223 Non-small cell lung cancer
    100481236
  Infectious diseases
   05166 HTLV-I infection
    100481236
   05162 Measles
    100481236
   05161 Hepatitis B
    100481236
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100481236
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   100481236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 303 aa AA seqDB search
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPELEESGAQLMLEMLTFNPHKRISAFRALQHSYLQKAEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctactcctcgatatgagccagtggctgagattggtgttggtgcctatggaacggta
tacaaggcccgtgatcctcacagcggccacttcgtggccctcaagagcgtaagagtccct
aatggaggaggtgctggagggggccttcccatcagcacagttcgtgaggtggccttactg
cggcggctggaggcttttgagcatcccaacgtcgtccggctgatggatgtctgtgccacc
gcccgaactgaccgggagaccaaagtgactctggtgtttgagcacgtggaccaagacctg
aggacatatctggacaaggcacccccaccaggcttgccagtggagaccatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgccaactgcatcgttcaccgagac
ctgaagccagagaacattctcgtgaccagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacgcctgtggttgttacactctggtat
cgtgctccagaagttcttctgcagtctacatacgcaacacccgtggacatgtggagtgtt
ggctgtatcttcgcagagatgtttcgtcgaaagcccctcttctgtggaaactctgaagct
gaccagttaggcaaaatcttcgacctgatcgggctgcccccagaggatgactggccccga
gatgtgtctctgccccgaggagccttttcccccagagggccccgcccagtgcagtcagtg
gtacctgagttggaggagtctggagcacaactgatgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt
aacccagagtga

DBGET integrated database retrieval system