KEGG   Ailuropoda melanoleuca (giant panda): 100481236Help
Entry
100481236         CDS       T01329                                 

Definition
cell division protein kinase 4-like
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Tight junction
T cell receptor signaling pathway
Hepatitis B
Measles
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Glioma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:aml04151]
Cellular Processes; Cell growth and death; Cell cycle [PATH:aml04110]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:aml04115]
Cellular Processes; Cell communication; Tight junction [PATH:aml04530]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:aml04660]
Human Diseases; Cancers; Pathways in cancer [PATH:aml05200]
Human Diseases; Cancers; Viral carcinogenesis [PATH:aml05203]
Human Diseases; Cancers; Pancreatic cancer [PATH:aml05212]
Human Diseases; Cancers; Glioma [PATH:aml05214]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:aml05220]
Human Diseases; Cancers; Melanoma [PATH:aml05218]
Human Diseases; Cancers; Bladder cancer [PATH:aml05219]
Human Diseases; Cancers; Small cell lung cancer [PATH:aml05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:aml05223]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:aml05166]
Human Diseases; Infectious diseases; Measles [PATH:aml05162]
Human Diseases; Infectious diseases; Hepatitis B [PATH:aml05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 303 aa AA seqDB search
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPELEESGAQLMLEMLTFNPHKRISAFRALQHSYLQKAEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctactcctcgatatgagccagtggctgagattggtgttggtgcctatggaacggta
tacaaggcccgtgatcctcacagcggccacttcgtggccctcaagagcgtaagagtccct
aatggaggaggtgctggagggggccttcccatcagcacagttcgtgaggtggccttactg
cggcggctggaggcttttgagcatcccaacgtcgtccggctgatggatgtctgtgccacc
gcccgaactgaccgggagaccaaagtgactctggtgtttgagcacgtggaccaagacctg
aggacatatctggacaaggcacccccaccaggcttgccagtggagaccatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgccaactgcatcgttcaccgagac
ctgaagccagagaacattctcgtgaccagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacgcctgtggttgttacactctggtat
cgtgctccagaagttcttctgcagtctacatacgcaacacccgtggacatgtggagtgtt
ggctgtatcttcgcagagatgtttcgtcgaaagcccctcttctgtggaaactctgaagct
gaccagttaggcaaaatcttcgacctgatcgggctgcccccagaggatgactggccccga
gatgtgtctctgccccgaggagccttttcccccagagggccccgcccagtgcagtcagtg
gtacctgagttggaggagtctggagcacaactgatgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt
aacccagagtga

DBGET integrated database retrieval system