KEGG   Ailuropoda melanoleuca (giant panda): 100481255Help
Entry
100481255         CDS       T01329                                 

Definition
(RefSeq) histone H2B subacrosomal variant
  KO
K11252  
histone H2B
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:aml00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100481255
  Immune diseases
   05322 Systemic lupus erythematosus
    100481255
  Substance dependence
   05034 Alcoholism
    100481255
Chromosome [BR:aml03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100481255
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100481255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 122 aa AA seqDB search
MARSITKKNKRSRGHRSPISKKKSHSSTDFGRRNYSLYINRVLKEVVPQRSISSRTLDVM
NTLIKDIFERISVEARSLMCFRNRCTLTPEDIQKAVYLLLPGKLAKYAVAFGSEAVQRYV
QS
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggccagatccatcaccaaaaagaacaagcgctccagaggacatcgaagcccaatctcc
aaaaagaaatcacattccagcactgattttggccgtagaaattattcgctctacattaac
agggtcctaaaggaagtggttccccagaggagcatatcatctcgtaccttggacgtcatg
aacaccctgatcaaggacatctttgagcgcatttctgtggaagcccgcagcctgatgtgt
ttcagaaatcgctgtaccctcacccctgaagatatccagaaggcagtgtacctgctgttg
cctgggaaactagctaagtatgcagtggcttttggaagtgaagccgtccaaagatacgtc
caatcctaa

DBGET integrated database retrieval system