KEGG   Ailuropoda melanoleuca (giant panda): 100481308Help
Entry
100481308         CDS       T01329                                 

Gene name
FLNB
Definition
(RefSeq) filamin B, beta
  KO
K04437  
filamin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100481308 (FLNB)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100481308 (FLNB)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100481308 (FLNB)
  Infectious diseases
   05132 Salmonella infection
    100481308 (FLNB)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100481308 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 2633 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRVGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPARFTVDTISAGQGDVMVFIEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVNVDKVQGDASKVTAK
GPGLEAAGNIANKSTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
VQPGPHVVKVSFAGDTIPKSPFVVQVGEACSPNACRASGRGLQPKGIRIRETADFKVDTK
SAGSGELGVTVKGPKGLEELVKQKGFLDGVYAFEYYPSTPGKYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHSGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPAAGDYNPDLVQAYGPGLEKAGC
IVNNLCEFTVDPKDAGKAPLKIFAQDGEGQPIDIQMKSRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPYSPYRVSIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENRKPTHFTVYTKGAGKAPLNVQFSGPLPGDAVKDLDVID
NYDYSHTVKYTPTQQGSMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKINGLENRVEVGK
GQEFAIDTKGAGGQGKLDVTILSPSRKVVPCMVAPVVGRESSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLQHGKVGEAGLLSVDCSEAGPGALGLEAISDSGAKAEVCIENNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPTRVKVEPAVDTSRVKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVRDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQVQGPGLKEAYTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYVPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKVAGPGLGSGVRARIL
QSFTVDSSKAGLAPLEVRVLGPRADEMDSQPWRSPLKAISEFFKVDPKGDFTETGLVESV
NIVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSS
YGVPASLPVEFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNEDGTYAVTYIPDKTGRYM
IGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVT
CTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEA
EAVEEAPVNACSPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSG
KTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGP
GLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYS
ILVKYNDKHIPGSPFTAKITDDSKRCSQVKLGSAADFLLDISETDLSTLTASIKAPSGRD
EPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGSHVANSPVSIMVVQSEIGDARRAKVYG
RGLSEGRTFEMSEFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGIY
IVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEIDSSDM
SAHVTSPSGRVTEAEIVSVGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLG
EGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCG
VSYIAQEPGNYEVSIKFNDEHIPDSPYLVPVIAPSDDARRLTVMSLQESGLKVNQPASFA
IRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHMIDVKFNGSHVVGS
PFKVRVGEPGQAGNPALVSAYGAGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKM
DCQETPEGYKVMYTPMAPGNYLIGVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSIL
VESVTRSSTETCFSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGV
HGPTTPCEEVSMKHMGNQQYNVTYIVKEKGDYVLAVKWGEEHIPGSPFHVTVP
NT seq 7902 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaaccgagaaggacctggcggaggacgcgccgtggaagaagatccagcagaac
accttcacgcgttggtgcaacgaacacctcaagtgcgtgaacaaacgcgttgggaacctg
cagaccgacctgagcgatgggttgcggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagtaccaccagcggcccaccttccgccagatgcagctggagaatgtg
tccgtggcgctcgagtttctggaccgtgagagcatcaagctcgtgtccatcgatagcaaa
gccatcgtggatgggaacctgaagctcatcttgggcctggtgtggacacttatccttcac
tactccatctctatgcctgtgtgggaggatgaaggggatgatgatgccaagaagcagaca
ccaaagcagaggctgctaggatggattcagaacaagatcccctacttgcccatcaccaac
ttcaaccagaactggcaagatggcaaggctctgggggccttagtagacagctgtgctccg
ggtctgtgcccagactgggaatcgtgggatccacgaaagcctgtggataatgcacgggaa
gctatgcagcaagcagacgactggctgggtgtcccacaggtcatcactcctgaagaaatt
attcatccagatgtggacgagcactcggtgatgacttacctgtcccagttccccaaagcc
aagctcaagcccggggctcctcttaaacccaaactcaacccaaagaaagccagggcctat
ggccgaggaatcgagcctacaggaaacatggtgaaacagccggccaggttcactgtggac
accatcagtgctgggcaaggagacgtgatggtgttcattgaggacccagaagggaacaaa
gaggaggcacaggtgacccccgacagcgacaagaacaagacatactctgtggagtatctg
cccaaggtcaccgggttgcacaaagttacagtcctctttgcaggacaacacatctccaag
agcccatttgaagtgaatgtcgacaaggtgcagggagatgccagtaaagtcaccgcaaaa
ggcccaggcttggaagctgccggcaacatcgccaataagtccacctacttcgacatctac
acagcaggtgctggtgtgggtgacattggtgttgaggtggaggatccccaggggaagaac
actgtggaattgctggtggaagataaaggaaatcaggtgtatcgatgtgtgtacaaacca
gtgcagcccggcccccacgtggtcaaggtctccttcgcaggggacaccattcccaagagt
cccttcgtcgtgcaggttggggaagcctgtagtccaaacgcctgccgggccagtggccga
ggcttgcagcccaaaggcatccgcatccgggagactgcagacttcaaggttgataccaaa
tcagctggaagtggggaactcggtgtcaccgtgaagggtcctaagggtctggaggagctg
gtgaaacagaaaggctttctggatggagtctatgcgttcgagtattaccccagcaccccg
gggaaatacagcatcgccatcacatgggggggacaccacattccaaagagcccctttgag
gttcaagttggccctgaagcaggcatgcagaaagttcgtgcatggggccctggcctccac
agtgggattgtcgggcggtcggcggacttcgtggttgagtctattggctctgaagtgggg
tctctaggctttgccattgaaggcccctcccaagcgaagattgagtatgacgaccagaat
gatgggtcatgtgatgtcaagtactggcccaaggaacctggcgaatatgctgttcacatc
atgtgtgatgatgaagacatcaaggacagcccatacatggccttcatccacccggctgca
ggagactacaacccggatctggtccaagcctacgggccaggtttggagaaagctgggtgc
attgtcaacaacctgtgtgaattcaccgtggatcctaaggatgctggaaaagctccctta
aagatatttgctcaggatggggaagggcagcccattgacatccagatgaagagccggatg
gatggcacatacgcctgctcgtacaccccggttaaggccatcaagcacaccatcgctgtg
gtctggggaggcgtgaacatcccatacagcccctacagggttagtatcgggcagggtagc
catccccagaaggtcaaggtgtttgggccaggcgtggagcgaagtggactgaaggcaaat
gagcctacgcatttcacagtggactgtactgaggctggagaaggtgatgtcagcgttggc
attaaatgtgatgcccgggtgttaagtgaggatgaggaagacgtggactttgacattatt
cacaacgccaacgacacgtttacggtcaaatatgtgcctcctgccgccgggcgatacact
atcaaagttctctttgcatctcaggaaatccccgccagccctttcagagtgaaagttgac
ccttcccatgacgccagcaaagtgaaggcagaaggcccggggctcagcaaagcaggtgtg
gaaaacaggaaaccaacccactttacggtctacaccaaaggggccggaaaagccccgctg
aacgtgcagttcagcggccccctccctggagatgccgtgaaggacttggacgtcatcgac
aattacgactactcccacaccgttaaatacacacccacccagcagggcagcatgcaggtg
ctggtgacgtatggaggcgaccccatccctaaaagccctttcaccgtgggcgtggccgct
ccgctggatctgagcaagatcaaaattaatgggctggaaaatagagtcgaagttgggaag
ggtcaggagttcgccatcgacacgaagggggcaggaggccaggggaagctggatgtgaca
atcctgagcccctcgaggaaggttgtgccttgcatggtggcgcccgtggtgggccgggag
agcagcacggccaagttcatccctcgggaggaggggctatatgccgtagacgtcacctat
gatggacaccctgtgcctgggagcccctacacggtggaggcctcattgccaccagatccc
accaaggtgaaggcccatggtcctggccttgaaggtggcctcgtgggcaagcccgctgag
ttcaccatcgacaccaaaggagcaggcaccggaggtctgggcctcaccgtggaaggtccg
tgcgaggccaaaattgaatgctctgacaatggtgatgggacctgttccgtctcttacctg
cccacaaagcccggggagtactttgtcaacattctctttgaagaagtccacataccgggt
tctcccttcaaagccgacattgaaatgcctttcgacccctctaaagtcgtggcttcagga
ccgggtctgcagcatgggaaggtgggcgaagccgggctgctgagtgttgactgttcagaa
gcagggcctggggccctgggcctggaagccatctcagattcgggagcgaaagccgaagtc
tgtattgaaaacaacaaagacggtacctacgcggtgacctacgtgcccctgaccgctggc
atgtacaccctgaccatgaagtatggcggtgagctggtgccccacttccccaccagggtc
aaggtggagccggccgtggacaccagcagggtcaaagtctttgggccaggaatagaagga
aaagatgtgtttcgcgaagccaccactgacttcacggtcgattcacggcccctgacccag
gtggggggcgaccacatcaaagcccacattgccaacccctcaggggcctctaccgagtgc
ttcgtcagggacaatgcggacgggacctaccaggtggagtacacacccttcgagaaaggt
ctccacgtagtggaggtgacatacgatgatgtgcccatcccaaacagtcccttcaaagtg
gctgtaaccgaaggctgccagccgtctcgggttcaagtgcaaggaccaggactgaaagag
gcctataccaacaaacccaatgtcttcactgtggttaccagaggggcaggcattggtggg
ctcggcatcactgtcgagggaccatccgagtcgaagatcaactgcagggacaacaaagat
ggaagctgtagtgcagagtacgtccccttcgctccaggggactacgacgttaacatcaca
tacggaggagcccacatccctggcagtcccttcagagtccctgtgaaggatgtcgtggac
cctagcaaggtcaaggttgctggccctgggctgggctctggtgtccgagcccgcatcttg
cagtctttcacagtggacagcagcaaggctggcctggcccctctggaagtgagggtcctg
ggcccacgagctgatgagatggattcccagccatggcgcagccccttgaaagccatttca
gagttctttaaagttgacccgaagggtgactttacggagacaggcctggtggagtcggtg
aacatagtggacaatggggatggcacacatacagtgacctacaccccatcccaggagggg
ccttacatggtctcggttaaatatgctgatgaagagatccctcgtagtcccttcaaggtc
aaggtccttcccacatacgatgccagcaaagtgactgccagtggccccggcctcagttcc
tatggcgtgcctgccagtctgcccgtggagtttgcaattgatgcccgagatgctggggaa
ggcctgcttgctgttcagatcacggaccaagagggaaaacccaaaagagccattgtccac
gacaatgaggatggcacgtacgccgtcacctacatccctgacaagactggacgctatatg
attggggtcacctacgggggggacgacatcccattgtcaccctatcgcatccgggccaca
cagacgggagatgccagcaagtgcctggccacaggtcctggaattgcctccactgtgaaa
accggcgaggaagtgggctttgtggtggatgccaagaccgctgggaaagggaaggtgacc
tgcacagttctgacccccgacggcaccgaggctgaggccgacgtcatcgagaatgaggat
ggcacttacgacatcttctacacagctgccaagccaggcacctatgtcatctacgtgcgc
tttggtggcgtcgatatccccaacagccccttcaccgttatggccacggatggggaagcc
gaggctgtggaggaggcaccggtaaatgcatgttcccccggattcaggccctgggtgact
gaagaagcctatgtccccgtgagtgacatgaacggcctggggttcaagcctttcgacttg
gtcattccattcgcggtcaggaaaggagaaatcaccggagaggtccacatgccttctggg
aagacggccacacctgagattgtggacaacaaggacggcacggtcactgtcagatatgcc
cccactgaggtcgggctgcatgagatgcacatcaaatacatgggcagccacatccctgaa
agcccgctccagttctatgtgaactacccgaacagtgggagcgtttctgcatacggtccg
ggcctggtgtacggagtggccaacaaaaccgccaccttcaccattgtcaccgaggatgca
ggagaaggtggcctcgacttggctattgaggggccctccaaggccgaaatcagctgcatt
gacaacaaagatgggacgtgcacggtgacctatctgcccaccctgccaggtgactacagc
atcctggtcaagtacaacgacaagcacatccctggcagccccttcacagccaagattaca
gacgatagcaaacggtgctctcaggtgaagctaggctctgccgccgacttcctgcttgac
atcagcgagacggacctgagcacgctgacggccagcatcaaggcgccgtcaggccgcgat
gagccctgtctcctcaagaggcttcccaacaaccacatcgggatctccttcatcccccgg
gaggtgggtgaacacctggtcagcatcaagaagaacggcagccacgtggccaacagccct
gtgtccatcatggtggtccagtccgagattggggatgcgcgcagagccaaagtctatggc
cggggtctgtcggagggccggacattcgagatgtctgaattcatcgtggacacaagggat
gcaggttacggtggcatatccttggcagtggaaggtcccagcaaagtggacatccagacg
gaggacctggaagatggcacctgcaaggtctcctacttccccacggtgcctggcatttac
attgtctccaccaagttcgctgacgagcatgtacctgggagcccgtttaccgtgaagatc
agcggggaggggagagtcaaggagagcatcacccgtaccagccgggctccgtctgtggcc
actgtcgggagcatctgtgacctgaacctgaaaatcccagaaattgacagcagtgacatg
tcggcccacgtcaccagcccctctggccgcgtcaccgaggcagagatcgtgtccgtgggg
aagaactcgcactgtgtccgctttgtgccccaggagatgggcgttcacacagtcagtgtc
aagtaccgcggccagcatgtgaccggcagccccttccagttcaccgtggggcctctgggc
gaggggggcgcccacaaggtccgcgcgggaggccccggcctggagagaggagaagcaggg
gttccagccgaattcagcatctggacccgggaggcaggcgctggcggcttgtctattgcc
gtcgagggccccagtaaggccgagattacgttcgatgaccataaaaatggatcgtgcggg
gtgtcttacattgcccaggagcctggtaactacgaggtgtctatcaagttcaacgatgag
cacatccccgatagtccttacctggtgccggtcatcgcgccctccgacgacgcccggcgc
ctcactgttatgagccttcaggaatcgggattaaaagttaaccagccagcctcctttgct
ataaggttgaatggggcaaaaggcaagatcgatgcaaaggtgcacagcccctccggagcc
gtggaggagtgccacgtgtctgagctggagccagacaagtacgccgtgcgcttcatcccc
cacgagaacggcatccacatgatcgacgtcaagttcaacgggagccacgtggttggaagc
cccttcaaagtgcgcgtcggggagcccggacaggcagggaaccccgccctggtgtccgcc
tatggtgccgggcttgaggggggcaccacaggtatccagtctgaatttttcatcaacacc
acccgagcagggccagggacattatccgtcaccattgaaggcccgtccaaagttaaaatg
gattgccaggaaaccccagaagggtacaaagttatgtacacccccatggctcctggaaac
tacctgattggcgtcaaatatggtgggcccaaccacattgtgggcagtccattcaaggcc
aaagtgacaggccagcgtctggtcagccctggctcagccaatgagacctcgtccattctg
gtggagtccgtgaccaggtcgtccacagagacctgctttagtgccatccccaaggcgtcc
tcagacgccagcaaggtgacctccaagggggcagggctctcaaaggccttcgtgggccag
aagagctccttcttggtggactgcagcaaagctggttccaacatgctgttgattggtgtc
catgggccaaccaccccctgtgaagaggtctccatgaagcacatgggcaaccagcaatac
aacgtcacatacatcgtcaaggagaagggagattatgttctggccgtgaagtggggagag
gagcacatccccggcagtcccttccacgtcacagtgccttaa

DBGET integrated database retrieval system