KEGG   Ailuropoda melanoleuca (giant panda): 100481360Help
Entry
100481360         CDS       T01329                                 

Definition
tyrosine-protein kinase JAK2-like
Orthology
K04447  
Janus kinase 2 [EC:2.7.10.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Cholinergic synapse
Prolactin signaling pathway
Adipocytokine signaling pathway
Leishmaniasis
Toxoplasmosis
Tuberculosis
Measles
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100481360
   04151 PI3K-Akt signaling pathway
    100481360
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    100481360
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    100481360
  Endocrine system
   04920 Adipocytokine signaling pathway
    100481360
   04917 Prolactin signaling pathway
    100481360
  Nervous system
   04725 Cholinergic synapse
    100481360
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100481360
   05162 Measles
    100481360
   05164 Influenza A
    100481360
   05168 Herpes simplex infection
    100481360
   05145 Toxoplasmosis
    100481360
   05140 Leishmaniasis
    100481360
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100481360
Protein kinases [BR:aml01001]
 Tyrosine protein kinases
  JAK family [OT]
   100481360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1163 aa AA seqDB search
MLSSSLFLCGLRELRSTGFQSGRARVFPSSRFQSSSTVGSGAPIFSLDVCPLPSSSSWYQ
SGSSERSRAPVFSVIARPGLTASVCFLLGAVLRFQPTPQFLLVLLPGITPVYHSMFALMS
ETERIWYPPNHVFHIDESTRQNVLYRIRFYFPYWYCNGSNRTYRHGISRGAEAPLLDDFV
MAYLFAQWRHDFLHGWIKIPVTHETQEECLGMAVLDMMRLAKEKDQTPLDIYSSISYKTF
LPKCVRAKIQDYHILTRKRIRYRFRRFIEQFSHCKATARNLKLKYLINLETLQSAFYTEQ
FEVKEPGSGPSGEEIFATIIITGNGGIQWSRGKHKESETLTEQDLQLYCDFPDIIDVTIK
QASQEGSNESRIVTIHKQDGKNLEIELSSLREALSFVSLIDGYYRLTADAHHYLCKEVAP
PMVLENIQSNCHGPILMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEY
KHCLITKNENGEYNLSGTKKNFSNLKDLLNCYQMETVRSDSIIFQFTKCCPPKLKDKSNL
LVFRTNGISDVPTSPTLQRHNNVNQMVFHKIRNEDLMFNESLGQGTFTKIFKGIRREVGD
YGQLHETEVLLKVLDKAHRNYSESFFEAASMMSQLSHKHLVLNYGVCVCGEENILVQEFV
KFGSLDTYLKKNKNSINILWKLEVAKQLAWAMHFLEEKALIHGNVCAKNILLIREEDRKT
GNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSG
GDKPLSALDSQRKLQFYEDRHQLPAPKWTELANLINNCMDYEPDFRPSFRAIIRDLNSLF
TPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYD
PLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLRLIM
EYLPYGSLRDYLQKHKERIDHKKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENR
VKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFT
YIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYLIMTECWNNN
VNQRPSFRDLALRVDQIRDNMAG
NT seq 3492 nt NT seq  +upstreamnt  +downstreamnt
atgctctcgagctccctgtttctgtgtggtttgcgcgagctccggagcaccggttttcag
tcaggacgcgcgcgtgtgtttccgagctctcggtttcagtctagttcgactgtgggctca
ggagctcccattttcagtctggacgtgtgcccgctcccgagctcgagctcctggtatcag
tctggctccagtgagcgctccagagctccggtttttagtgtgatcgcgcgtcccgggctc
acggcctcagtctgctttctcttgggtgctgttctgcgattccagcccaccccccagttc
ctgttggtactgcttcccggaatcacacctgtgtatcatagtatgtttgctttaatgagt
gaaacagaaaggatctggtatccacccaaccatgtcttccatatagatgaatcaaccaga
caaaatgtactctacagaataagattttactttccttactggtattgtaatggcagcaac
agaacctatcggcatggaatatctcgaggtgctgaagctcctcttcttgacgactttgtc
atggcttacctttttgctcagtggcggcatgattttttacatggatggataaaaatacct
gtgacccatgaaacacaggaagaatgtcttggaatggctgtgttagatatgatgagacta
gccaaagagaaggatcaaaccccactggacatctatagttctatcagctacaagacattc
ttaccaaaatgtgttcgagcaaagatccaagactatcatattttgacaaggaaacgaata
aggtacaggtttcgcagatttattgagcaattcagccattgcaaagccactgccagaaac
ttgaaacttaagtatcttataaatctggaaactcttcagtctgccttctacacagagcag
tttgaagtaaaagaacctggaagtggtccttcaggtgaggagatttttgcaaccattata
ataactggaaacggtggaattcagtggtcaagagggaaacataaagaaagtgagacactg
acagaacaggatttacagttatattgtgactttcctgatattattgatgttactattaag
caagcaagccaagaaggctcaaatgaaagtagaattgtaactatccataagcaagatggt
aaaaacctggaaattgaacttagctcattaagagaagctttgtcctttgtgtcattaatt
gatggctattatagattaaccgcagatgcacatcattacctctgtaaagaagtagcacct
ccaatggtccttgaaaatatacaaagcaactgtcatggcccaattttaatggatttcgcc
atcagtaaactaaagaaagcaggtaatcagactggactctatgtacttcgatgcagtcct
aaggactttaataagtattttctgacttttgctgtcgagcgagaaaatgtcattgaatat
aagcactgtttgattacaaaaaatgagaatggagaatacaacctcagtgggaccaagaag
aacttcagtaatcttaaagatcttttgaattgctaccaaatggaaactgttcgctcagac
agtataattttccagtttactaaatgctgtcccccaaagttgaaagataaatcaaacctt
ctagtcttcagaaccaatggtatttctgatgttccaacatcaccgacattacagaggcat
aataatgtgaaccaaatggtgtttcacaaaatcagaaatgaagatttgatgtttaatgaa
agccttggtcaaggcacttttacaaaaatttttaaaggtataagaagagaagtaggagac
tatggtcaactccatgaaacagaagttcttttaaaagttctggataaagcacacagaaac
tactcagagtctttctttgaagcagcaagcatgatgagccagctttctcacaagcatctg
gttttaaattatggagtatgtgtctgtggggaggagaatattctggttcaagagtttgta
aaatttggatcattagatacatatctgaaaaagaataaaaattctataaatatattatgg
aaacttgaagtggctaaacagttggcatgggccatgcattttctagaagaaaaagcactt
attcatggaaatgtgtgtgccaaaaatattctgcttatcagagaagaagacaggaagaca
ggaaatcctcctttcatcaaacttagtgatcctggcattagtattacagttttgccaaag
gacattcttcaggagagaataccatgggtaccacctgaatgcatcgaaaatcctaaaaat
ctaaatttggcaacagacaaatggagttttggtaccactttgtgggaaatctgcagtgga
ggagataagcctctgagtgctttggattctcaaagaaagctacagttttatgaagatagg
caccagcttcctgcaccaaagtggacagaattagcaaatcttattaataattgtatggat
tatgaaccagattttagaccttctttcagagccatcatacgagatcttaatagtttgttt
actccagattatgaactattaacagaaaatgacatgttaccaaatatgagaataggtgcc
ctagggttttctggtgcttttgaagaccgagaccctacacagtttgaagagagacacttg
aaatttctacagcaacttggcaagggtaattttggcagtgtggagatgtgccggtatgac
cctctgcaagacaacactggggaggtggtggctgtgaagaagctccagcacagtactgaa
gagcacctgcgagactttgaaagggaaattgaaatcctcaaatcgctgcagcatgacaac
attgtgaagtacaagggagtgtgctacagtgctggtcggcgtaatctaagattaattatg
gaatatttaccatatggaagtttacgagactatctccaaaaacataaagaacggatagat
cataaaaaacttctgcagtatacatctcagatatgcaagggcatggagtatcttggtaca
aaaaggtatatccacagggatctggcaacaaggaatatattggtggaaaacgaaaacaga
gttaaaattggagattttgggttaaccaaagtcttgccacaagacaaagaatactacaaa
gtaaaagaacctggtgaaagtcccatattctggtatgctccagaatcactgacggagagc
aagttttctgtggcttcagatgtctggagctttggagtggttctgtatgaacttttcacg
tatattgagaagagtaaaagtcccccagcggaatttatgcgtatgattggcaatgacaaa
caaggacagatgattgtgtttcatttgatagaactcctaaagaataatggaagattacca
agaccagatggatgcccagatgagatttatttgatcatgacagaatgctggaacaataat
gtcaatcaacgcccctcttttagagacctagctcttcgagttgatcaaataagggacaac
atggctggatga

DBGET integrated database retrieval system