KEGG   Ailuropoda melanoleuca (giant panda): 100481360Help
Entry
100481360         CDS       T01329                                 

Definition
tyrosine-protein kinase JAK2-like
Orthology
K04447  
Janus kinase 2 [EC:2.7.10.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Cholinergic synapse
Prolactin signaling pathway
Adipocytokine signaling pathway
Leishmaniasis
Toxoplasmosis
Tuberculosis
Measles
Influenza A
Herpes simplex infection
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:aml04630]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:aml04151]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:aml04062]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:aml04920]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:aml04917]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:aml04725]
Human Diseases; Infectious diseases; Tuberculosis [PATH:aml05152]
Human Diseases; Infectious diseases; Measles [PATH:aml05162]
Human Diseases; Infectious diseases; Influenza A [PATH:aml05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:aml05168]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:aml05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:aml05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1163 aa AA seqDB search
MLSSSLFLCGLRELRSTGFQSGRARVFPSSRFQSSSTVGSGAPIFSLDVCPLPSSSSWYQ
SGSSERSRAPVFSVIARPGLTASVCFLLGAVLRFQPTPQFLLVLLPGITPVYHSMFALMS
ETERIWYPPNHVFHIDESTRQNVLYRIRFYFPYWYCNGSNRTYRHGISRGAEAPLLDDFV
MAYLFAQWRHDFLHGWIKIPVTHETQEECLGMAVLDMMRLAKEKDQTPLDIYSSISYKTF
LPKCVRAKIQDYHILTRKRIRYRFRRFIEQFSHCKATARNLKLKYLINLETLQSAFYTEQ
FEVKEPGSGPSGEEIFATIIITGNGGIQWSRGKHKESETLTEQDLQLYCDFPDIIDVTIK
QASQEGSNESRIVTIHKQDGKNLEIELSSLREALSFVSLIDGYYRLTADAHHYLCKEVAP
PMVLENIQSNCHGPILMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEY
KHCLITKNENGEYNLSGTKKNFSNLKDLLNCYQMETVRSDSIIFQFTKCCPPKLKDKSNL
LVFRTNGISDVPTSPTLQRHNNVNQMVFHKIRNEDLMFNESLGQGTFTKIFKGIRREVGD
YGQLHETEVLLKVLDKAHRNYSESFFEAASMMSQLSHKHLVLNYGVCVCGEENILVQEFV
KFGSLDTYLKKNKNSINILWKLEVAKQLAWAMHFLEEKALIHGNVCAKNILLIREEDRKT
GNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSG
GDKPLSALDSQRKLQFYEDRHQLPAPKWTELANLINNCMDYEPDFRPSFRAIIRDLNSLF
TPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYD
PLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLRLIM
EYLPYGSLRDYLQKHKERIDHKKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENR
VKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFT
YIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYLIMTECWNNN
VNQRPSFRDLALRVDQIRDNMAG
NT seq 3492 nt NT seq  +upstreamnt  +downstreamnt
atgctctcgagctccctgtttctgtgtggtttgcgcgagctccggagcaccggttttcag
tcaggacgcgcgcgtgtgtttccgagctctcggtttcagtctagttcgactgtgggctca
ggagctcccattttcagtctggacgtgtgcccgctcccgagctcgagctcctggtatcag
tctggctccagtgagcgctccagagctccggtttttagtgtgatcgcgcgtcccgggctc
acggcctcagtctgctttctcttgggtgctgttctgcgattccagcccaccccccagttc
ctgttggtactgcttcccggaatcacacctgtgtatcatagtatgtttgctttaatgagt
gaaacagaaaggatctggtatccacccaaccatgtcttccatatagatgaatcaaccaga
caaaatgtactctacagaataagattttactttccttactggtattgtaatggcagcaac
agaacctatcggcatggaatatctcgaggtgctgaagctcctcttcttgacgactttgtc
atggcttacctttttgctcagtggcggcatgattttttacatggatggataaaaatacct
gtgacccatgaaacacaggaagaatgtcttggaatggctgtgttagatatgatgagacta
gccaaagagaaggatcaaaccccactggacatctatagttctatcagctacaagacattc
ttaccaaaatgtgttcgagcaaagatccaagactatcatattttgacaaggaaacgaata
aggtacaggtttcgcagatttattgagcaattcagccattgcaaagccactgccagaaac
ttgaaacttaagtatcttataaatctggaaactcttcagtctgccttctacacagagcag
tttgaagtaaaagaacctggaagtggtccttcaggtgaggagatttttgcaaccattata
ataactggaaacggtggaattcagtggtcaagagggaaacataaagaaagtgagacactg
acagaacaggatttacagttatattgtgactttcctgatattattgatgttactattaag
caagcaagccaagaaggctcaaatgaaagtagaattgtaactatccataagcaagatggt
aaaaacctggaaattgaacttagctcattaagagaagctttgtcctttgtgtcattaatt
gatggctattatagattaaccgcagatgcacatcattacctctgtaaagaagtagcacct
ccaatggtccttgaaaatatacaaagcaactgtcatggcccaattttaatggatttcgcc
atcagtaaactaaagaaagcaggtaatcagactggactctatgtacttcgatgcagtcct
aaggactttaataagtattttctgacttttgctgtcgagcgagaaaatgtcattgaatat
aagcactgtttgattacaaaaaatgagaatggagaatacaacctcagtgggaccaagaag
aacttcagtaatcttaaagatcttttgaattgctaccaaatggaaactgttcgctcagac
agtataattttccagtttactaaatgctgtcccccaaagttgaaagataaatcaaacctt
ctagtcttcagaaccaatggtatttctgatgttccaacatcaccgacattacagaggcat
aataatgtgaaccaaatggtgtttcacaaaatcagaaatgaagatttgatgtttaatgaa
agccttggtcaaggcacttttacaaaaatttttaaaggtataagaagagaagtaggagac
tatggtcaactccatgaaacagaagttcttttaaaagttctggataaagcacacagaaac
tactcagagtctttctttgaagcagcaagcatgatgagccagctttctcacaagcatctg
gttttaaattatggagtatgtgtctgtggggaggagaatattctggttcaagagtttgta
aaatttggatcattagatacatatctgaaaaagaataaaaattctataaatatattatgg
aaacttgaagtggctaaacagttggcatgggccatgcattttctagaagaaaaagcactt
attcatggaaatgtgtgtgccaaaaatattctgcttatcagagaagaagacaggaagaca
ggaaatcctcctttcatcaaacttagtgatcctggcattagtattacagttttgccaaag
gacattcttcaggagagaataccatgggtaccacctgaatgcatcgaaaatcctaaaaat
ctaaatttggcaacagacaaatggagttttggtaccactttgtgggaaatctgcagtgga
ggagataagcctctgagtgctttggattctcaaagaaagctacagttttatgaagatagg
caccagcttcctgcaccaaagtggacagaattagcaaatcttattaataattgtatggat
tatgaaccagattttagaccttctttcagagccatcatacgagatcttaatagtttgttt
actccagattatgaactattaacagaaaatgacatgttaccaaatatgagaataggtgcc
ctagggttttctggtgcttttgaagaccgagaccctacacagtttgaagagagacacttg
aaatttctacagcaacttggcaagggtaattttggcagtgtggagatgtgccggtatgac
cctctgcaagacaacactggggaggtggtggctgtgaagaagctccagcacagtactgaa
gagcacctgcgagactttgaaagggaaattgaaatcctcaaatcgctgcagcatgacaac
attgtgaagtacaagggagtgtgctacagtgctggtcggcgtaatctaagattaattatg
gaatatttaccatatggaagtttacgagactatctccaaaaacataaagaacggatagat
cataaaaaacttctgcagtatacatctcagatatgcaagggcatggagtatcttggtaca
aaaaggtatatccacagggatctggcaacaaggaatatattggtggaaaacgaaaacaga
gttaaaattggagattttgggttaaccaaagtcttgccacaagacaaagaatactacaaa
gtaaaagaacctggtgaaagtcccatattctggtatgctccagaatcactgacggagagc
aagttttctgtggcttcagatgtctggagctttggagtggttctgtatgaacttttcacg
tatattgagaagagtaaaagtcccccagcggaatttatgcgtatgattggcaatgacaaa
caaggacagatgattgtgtttcatttgatagaactcctaaagaataatggaagattacca
agaccagatggatgcccagatgagatttatttgatcatgacagaatgctggaacaataat
gtcaatcaacgcccctcttttagagacctagctcttcgagttgatcaaataagggacaac
atggctggatga

DBGET integrated database retrieval system