KEGG   Ailuropoda melanoleuca (giant panda): 100481376Help
Entry
100481376         CDS       T01329                                 

Definition
5'-AMP-activated protein kinase catalytic subunit alpha-2-like
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
PI3K-Akt signaling pathway
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:aml04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:aml04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:aml04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:aml04140]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:aml04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:aml04920]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:aml04921]
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:aml04710]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:aml05410]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:aml04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 844 aa AA seqDB search
MTSDLLKWGYLDGETPVQGTQRGRHIHMKTTIFSQEDRHGTPLPSQPSEGTTLHHFDLGL
VATRAPPKSILLCLSDVRAALLGLDLPVSTPEESRAGTPPSSSLDPDTRHSTCLIFSVTY
NLTLQLIPKAACLGLTLFTISSIQHGSPKDTRDTGKRKKRLQLSGEPDLPDNTNFKLTIL
HPLTAFPSGERHGSPAFQTQPDQAPASSNASQPSWCKLSSPTLWYQKPNEEQPQSVRKSR
GKRARCRAETAAELCCSGRAGLARVRLRERVSGQRGRSAAFLGCCLLNEWELLRARPLRS
ACPNSNFSSSSSCCRRGCCCGRLVGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNL
KLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEVEARRLFQQILSAVD
YCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGR
LYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHM
LQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVM
NSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTGSFMDDSTMHIPPGLKPHPE
RMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDF
EWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQR
SCSAAGLHRPRSSFDSVTAESHSLSGSLTGSLTGSTLSSVPPRLGSHTMDFFEMCASLIT
TLAR
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcgacctgctaaaatggggatatctggacggagagacgcccgtacagggcaca
cagagaggacgccatattcacatgaagaccaccatcttcagccaagaagacagacatgga
acacctcttccctcacaaccttcagaaggaaccaccttgcatcactttgatcttggactt
gtagccaccagagctcctcccaagtcaattctgctttgtctgtctgatgtccgtgctgcg
cttctaggcctggatctaccagtgtccactccagaagagtcacgggcagggaccccgccc
agctcatcattagatcccgacaccaggcacagtacctgtttaatttttagtgtaacttac
aatctgacgctgcaactaattcctaaggctgcgtgcttgggtcttacactctttaccatc
tccagcatccagcacgggagtccaaaagacacacgtgacacaggcaagagaaagaagaga
ttacagctctccggagaaccagacctcccggacaataccaatttcaaactgacaatactc
cacccgttgactgcatttcctagtggggaacggcacgggagtccggcctttcagactcaa
cctgaccaagcccctgcttcttcgaacgcctcgcagccctcctggtgtaagctcagctca
cctaccctctggtatcaaaagccaaatgaggaacagccccaaagcgtccgaaagtccagg
gggaagagagcccgctgccgagcagaaactgctgcagagctgtgctgctcggggcgcgct
gggctggcgcgtgtccggctgcgcgagcgggtgagtgggcagcgcgggcgctcggccgcc
ttcctcggctgctgcttacttaatgaatgggagctgctccgagcccggccgctccggagc
gcctgccccaactccaacttttcttcctcctcctcctgctgccgccgcggctgctgttgt
ggtcgcctggttggagaacatcaattgacaggccataaagtggcagttaaaatcttaaat
agacagaagattcgcagtttagatgttgttggaaaaataaaacgagaaattcaaaaccta
aaactctttcgtcatcctcatataatcaaactataccaggtgatcagcactccaacagat
ttttttatggtgatggaatatgtgtctggtggtgaattatttgactacatctgtaaacat
ggacgggttgaagaggtggaagcaaggcggctctttcagcagattctgtcagctgtggat
tactgtcataggcatatggtggttcatcgagacctgaaaccagagaatgtgctgttggat
gctcacatgaatgccaagatagctgattttggattgtctaatatgatgtcagatggtgaa
tttctgcgaaccagttgtggatctccaaattatgcagcacctgaagtcatctcaggcaga
ttgtatgcaggtcctgaagttgatatctggagctgtggtgttattttgtatgcccttctt
tgtggcaccctcccatttgatgatgagcatgtacctacgttatttaagaagatccgaggg
ggtgttttttatatcccagaatatctcaatcgttctgttgccactctcttgatgcatatg
ctgcaggttgaccccctgaaacgagcaaccatcaaagatataagagagcatgaatggttt
aaacaagatttgcccagttacttatttcctgaagacccctcctatgatgctaacgtcatt
gatgatgaggctgtgaaagaagtgtgtgaaaaatttgagtgtacagaatcagaagtaatg
aacagtttatatagtggtgaccctcaagaccagcttgcagtggcttatcatcttatcatt
gacaatcggagaataatgaaccaagccagtgagttctacctcgcctctagtcccccaaca
ggttcttttatggatgatagtaccatgcatattcccccaggcctgaaacctcatccagaa
cggatgccacctcttatagcagacagccctaaagcgagatgtccattggatgcactgaac
acaactaagcccaaatctttagctgtgaaaaaagccaagtggcatcttggaatcagaagt
caaagcaaaccgtatgacattatggctgaggtctaccgagctatgaagcagctggatttt
gaatggaaggtagtgaatgcataccatcttcgtgtaagaaggaaaaatccagtgactggc
aattatgtgaaaatgagcttacaactttacctggttgacaacagaagctatcttttggac
tttaaaagcattgatgatgaggtggtggagcagaggtctggttcttcaacacctcagcgt
tcctgttctgctgctggcttacatagaccaagatcaagttttgattctgtaactgcagag
agccattcactttctggctctctcactggctctttgaccggaagcacattgtcttcagtt
ccaccccgcctaggcagtcacaccatggatttttttgaaatgtgtgccagtctgatcact
accttagcccgttga

DBGET integrated database retrieval system