KEGG   Ailuropoda melanoleuca (giant panda): 100481376Help
Entry
100481376         CDS       T01329                                 

Gene name
PRKAA2
Definition
(RefSeq) protein kinase, AMP-activated, alpha 2 catalytic subunit
  KO
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100481376 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    100481376 (PRKAA2)
   04152 AMPK signaling pathway
    100481376 (PRKAA2)
   04150 mTOR signaling pathway
    100481376 (PRKAA2)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    100481376 (PRKAA2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100481376 (PRKAA2)
   04922 Glucagon signaling pathway
    100481376 (PRKAA2)
   04920 Adipocytokine signaling pathway
    100481376 (PRKAA2)
   04921 Oxytocin signaling pathway
    100481376 (PRKAA2)
  Environmental adaptation
   04710 Circadian rhythm
    100481376 (PRKAA2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100481376 (PRKAA2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100481376 (PRKAA2)
   04931 Insulin resistance
    100481376 (PRKAA2)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100481376 (PRKAA2)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   100481376 (PRKAA2)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100481376 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    100481376 (PRKAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 532 aa AA seqDB search
MTASFFFFFSLVGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKLFRHPHIIKLY
QVISTPTDFFMVMEYVSGGELFDYICKHGRVEEVEARRLFQQILSAVDYCHRHMVVHRDL
KPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSC
GVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIK
DIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQL
AVAYHLIIDNRRIMNQASEFYLASSPPTGSFMDDSTMHIPPGLKPHPERMPPLIADSPKA
RCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRV
RRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRS
SFDSVTAESHSLSGSLTGSLTGSTLSSVPPRLGSHTMDFFEMCASLITTLAR
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaagttttttctttttcttttctttagttggagaacatcaattgacaggccat
aaagtggcagttaaaatcttaaatagacagaagattcgcagtttagatgttgttggaaaa
ataaaacgagaaattcaaaacctaaaactctttcgtcatcctcatataatcaaactatac
caggtgatcagcactccaacagatttttttatggtgatggaatatgtgtctggtggtgaa
ttatttgactacatctgtaaacatggacgggttgaagaggtggaagcaaggcggctcttt
cagcagattctgtcagctgtggattactgtcataggcatatggtggttcatcgagacctg
aaaccagagaatgtgctgttggatgctcacatgaatgccaagatagctgattttggattg
tctaatatgatgtcagatggtgaatttctgcgaaccagttgtggatctccaaattatgca
gcacctgaagtcatctcaggcagattgtatgcaggtcctgaagttgatatctggagctgt
ggtgttattttgtatgcccttctttgtggcaccctcccatttgatgatgagcatgtacct
acgttatttaagaagatccgagggggtgttttttatatcccagaatatctcaatcgttct
gttgccactctcttgatgcatatgctgcaggttgaccccctgaaacgagcaaccatcaaa
gatataagagagcatgaatggtttaaacaagatttgcccagttacttatttcctgaagac
ccctcctatgatgctaacgtcattgatgatgaggctgtgaaagaagtgtgtgaaaaattt
gagtgtacagaatcagaagtaatgaacagtttatatagtggtgaccctcaagaccagctt
gcagtggcttatcatcttatcattgacaatcggagaataatgaaccaagccagtgagttc
tacctcgcctctagtcccccaacaggttcttttatggatgatagtaccatgcatattccc
ccaggcctgaaacctcatccagaacggatgccacctcttatagcagacagccctaaagcg
agatgtccattggatgcactgaacacaactaagcccaaatctttagctgtgaaaaaagcc
aagtggcatcttggaatcagaagtcaaagcaaaccgtatgacattatggctgaggtctac
cgagctatgaagcagctggattttgaatggaaggtagtgaatgcataccatcttcgtgta
agaaggaaaaatccagtgactggcaattatgtgaaaatgagcttacaactttacctggtt
gacaacagaagctatcttttggactttaaaagcattgatgatgaggtggtggagcagagg
tctggttcttcaacacctcagcgttcctgttctgctgctggcttacatagaccaagatca
agttttgattctgtaactgcagagagccattcactttctggctctctcactggctctttg
accggaagcacattgtcttcagttccaccccgcctaggcagtcacaccatggattttttt
gaaatgtgtgccagtctgatcactaccttagcccgttga

DBGET integrated database retrieval system