KEGG   Ailuropoda melanoleuca (giant panda): 100481376Help
Entry
100481376         CDS       T01329                                 

Definition
5'-AMP-activated protein kinase catalytic subunit alpha-2-like
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100481376
   04151 PI3K-Akt signaling pathway
    100481376
   04152 AMPK signaling pathway
    100481376
   04150 mTOR signaling pathway
    100481376
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    100481376
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100481376
   04920 Adipocytokine signaling pathway
    100481376
   04921 Oxytocin signaling pathway
    100481376
  Environmental adaptation
   04710 Circadian rhythm
    100481376
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100481376
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100481376
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100481376
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   100481376
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100481376
  Mitophagy factors
   Other mitophagy factors
    100481376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 844 aa AA seqDB search
MTSDLLKWGYLDGETPVQGTQRGRHIHMKTTIFSQEDRHGTPLPSQPSEGTTLHHFDLGL
VATRAPPKSILLCLSDVRAALLGLDLPVSTPEESRAGTPPSSSLDPDTRHSTCLIFSVTY
NLTLQLIPKAACLGLTLFTISSIQHGSPKDTRDTGKRKKRLQLSGEPDLPDNTNFKLTIL
HPLTAFPSGERHGSPAFQTQPDQAPASSNASQPSWCKLSSPTLWYQKPNEEQPQSVRKSR
GKRARCRAETAAELCCSGRAGLARVRLRERVSGQRGRSAAFLGCCLLNEWELLRARPLRS
ACPNSNFSSSSSCCRRGCCCGRLVGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNL
KLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEVEARRLFQQILSAVD
YCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGR
LYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHM
LQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVM
NSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTGSFMDDSTMHIPPGLKPHPE
RMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDF
EWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQR
SCSAAGLHRPRSSFDSVTAESHSLSGSLTGSLTGSTLSSVPPRLGSHTMDFFEMCASLIT
TLAR
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcgacctgctaaaatggggatatctggacggagagacgcccgtacagggcaca
cagagaggacgccatattcacatgaagaccaccatcttcagccaagaagacagacatgga
acacctcttccctcacaaccttcagaaggaaccaccttgcatcactttgatcttggactt
gtagccaccagagctcctcccaagtcaattctgctttgtctgtctgatgtccgtgctgcg
cttctaggcctggatctaccagtgtccactccagaagagtcacgggcagggaccccgccc
agctcatcattagatcccgacaccaggcacagtacctgtttaatttttagtgtaacttac
aatctgacgctgcaactaattcctaaggctgcgtgcttgggtcttacactctttaccatc
tccagcatccagcacgggagtccaaaagacacacgtgacacaggcaagagaaagaagaga
ttacagctctccggagaaccagacctcccggacaataccaatttcaaactgacaatactc
cacccgttgactgcatttcctagtggggaacggcacgggagtccggcctttcagactcaa
cctgaccaagcccctgcttcttcgaacgcctcgcagccctcctggtgtaagctcagctca
cctaccctctggtatcaaaagccaaatgaggaacagccccaaagcgtccgaaagtccagg
gggaagagagcccgctgccgagcagaaactgctgcagagctgtgctgctcggggcgcgct
gggctggcgcgtgtccggctgcgcgagcgggtgagtgggcagcgcgggcgctcggccgcc
ttcctcggctgctgcttacttaatgaatgggagctgctccgagcccggccgctccggagc
gcctgccccaactccaacttttcttcctcctcctcctgctgccgccgcggctgctgttgt
ggtcgcctggttggagaacatcaattgacaggccataaagtggcagttaaaatcttaaat
agacagaagattcgcagtttagatgttgttggaaaaataaaacgagaaattcaaaaccta
aaactctttcgtcatcctcatataatcaaactataccaggtgatcagcactccaacagat
ttttttatggtgatggaatatgtgtctggtggtgaattatttgactacatctgtaaacat
ggacgggttgaagaggtggaagcaaggcggctctttcagcagattctgtcagctgtggat
tactgtcataggcatatggtggttcatcgagacctgaaaccagagaatgtgctgttggat
gctcacatgaatgccaagatagctgattttggattgtctaatatgatgtcagatggtgaa
tttctgcgaaccagttgtggatctccaaattatgcagcacctgaagtcatctcaggcaga
ttgtatgcaggtcctgaagttgatatctggagctgtggtgttattttgtatgcccttctt
tgtggcaccctcccatttgatgatgagcatgtacctacgttatttaagaagatccgaggg
ggtgttttttatatcccagaatatctcaatcgttctgttgccactctcttgatgcatatg
ctgcaggttgaccccctgaaacgagcaaccatcaaagatataagagagcatgaatggttt
aaacaagatttgcccagttacttatttcctgaagacccctcctatgatgctaacgtcatt
gatgatgaggctgtgaaagaagtgtgtgaaaaatttgagtgtacagaatcagaagtaatg
aacagtttatatagtggtgaccctcaagaccagcttgcagtggcttatcatcttatcatt
gacaatcggagaataatgaaccaagccagtgagttctacctcgcctctagtcccccaaca
ggttcttttatggatgatagtaccatgcatattcccccaggcctgaaacctcatccagaa
cggatgccacctcttatagcagacagccctaaagcgagatgtccattggatgcactgaac
acaactaagcccaaatctttagctgtgaaaaaagccaagtggcatcttggaatcagaagt
caaagcaaaccgtatgacattatggctgaggtctaccgagctatgaagcagctggatttt
gaatggaaggtagtgaatgcataccatcttcgtgtaagaaggaaaaatccagtgactggc
aattatgtgaaaatgagcttacaactttacctggttgacaacagaagctatcttttggac
tttaaaagcattgatgatgaggtggtggagcagaggtctggttcttcaacacctcagcgt
tcctgttctgctgctggcttacatagaccaagatcaagttttgattctgtaactgcagag
agccattcactttctggctctctcactggctctttgaccggaagcacattgtcttcagtt
ccaccccgcctaggcagtcacaccatggatttttttgaaatgtgtgccagtctgatcact
accttagcccgttga

DBGET integrated database retrieval system