KEGG   Ailuropoda melanoleuca (giant panda): 100481404Help
Entry
100481404         CDS       T01329                                 

Gene name
USP37
Definition
ubiquitin specific peptidase 37
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 980 aa AA seqDB search
MSPLKIHGPIRIRSMQTGITKWKEGSFEIVEKENKVSLVVHYNTGGIPRIFQLSHNIKNV
VLRPSGAKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLDAVHQNRLHAAMKPSQGSGSF
GAILGSRTSQKETNRQLSYSDNQASSKRGSLETKDDIPFRKVLGNPGRGSIKTATGSGIT
VTRTIPSLTSTSTPLRSGLLENRTEKRKRMLSGSELNEDYPKENDSSSNNKAMTDPSRKY
LTSSREKQLSLKQSEENRTSGLLPLQSSSFYGSRTGSKDYSSGSTNLDRTNVSSQTPSAK
RSLGFLPQPAPLSVKKLRCNQDYTGWNKPRVPLSSHQQQQLQGFSNLGNTCYMNAILQSL
FSLQSFANDLLKQGIPWKKIPLNALIRRFAHLLVKKDICNSETKKDLLKKVKNAISATAE
RFSGYMQNDAHEFLSQCLDQLKEDMEKLNKTWKTEPVPGEENSSDISATRVYTCPVITNL
EFEVQHSIICKACGEIIPKREQFNDLSIDLPRRKKPLPPRSIQDSLDLFFRAEELEYSCE
KCGGKCALVRHKFNRLPRILILHLKRYSFNVTLSLNNKIGQQVIIPRYLTLSSHCTENTK
PPFTLGWSAHMAISRPLKASQMVNSCITSPSTPSKNFTFKSKSSLALCLDSDSEDELKRS
VALSQRLCEMSGCEQQQEDLEKDSKSCRIEPDKSELENSGFDGMSEEELLAAVLEMSKRE
SSPTLSHEDDDKPTSSPDTGFAEDDIQEMPENQEPVETEKPKTVTEPDSASFTEITKDCD
ENKENKTPEGSQGEVDWLQQYDMEREREEQELQQALAQSLQEQEAWEQKEDDDLKRATEL
SLQEFNNSFLDSLGSDEDSGNEDVLDMEYTEAEAEELKRNAETGNLPHSYRLISVVSHIG
STSSSGHYISDVYDIKKQAWFTYNDLEVSKIQEASVQSDRDRSGYIFFYMHKEIFDELLE
TEKNSQALSMEVGKTTRQAL
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctctgaagatacacggtcctatcagaattcgaagtatgcagactggaattaca
aaatggaaagaagggtcctttgaaattgtggaaaaagagaataaagtcagcctagtagtt
cactacaatactggaggaattccaaggatatttcagctaagtcataacattaaaaatgtg
gtgcttcgacctagtggagcaaaacaaagccgcctaatgttaactctacaagataacagc
ttcttgtctattgataaagtgccaagtaaggatgcagaggaaatgaggttgtttctagat
gcagtccatcaaaacagacttcatgcagctatgaaaccttctcaagggtctggtagtttt
ggagctattctgggcagcaggacttcacagaaggaaaccaacaggcagctttcttactca
gacaatcaggcatcttcaaaaagaggaagtttggaaactaaagatgatattccatttcga
aaagttcttggtaatccaggtagaggatcaattaagactgcaacaggaagtggaataact
gtcacccggacaattccgtctttgacatctacatcaacccctcttagatcagggttatta
gaaaataggactgaaaaaaggaaaagaatgttatctggctcagagttgaatgaagattac
cctaaggaaaatgattcatcatcgaacaacaaggctatgacagatccctccagaaagtat
ttaaccagcagtagagagaagcagctgagtttgaaacagtcagaagagaataggacatca
ggacttttacctttacagtcatcatccttttatggcagcagaactggatccaaggactac
tcctctggtagcactaacttagacaggactaatgtttcaagccaaactccctctgccaaa
agaagtttgggatttcttcctcaaccagctcctctttctgttaaaaaactaaggtgtaac
caggattacactggctggaacaaaccaagagtgcccctttcctctcaccaacagcagcaa
ctgcagggcttctccaatttgggaaatacctgctatatgaacgctattttacaatctctg
ttttcactccagtcatttgcaaatgacttgcttaagcaaggtatcccgtggaagaaaatt
ccactgaatgcacttatcagacgctttgcacacttgcttgttaaaaaagatatctgtaat
tcagagaccaaaaaagatttactcaagaaggttaagaatgccatttcagctacagcagag
agattctctggttatatgcagaatgatgctcatgaatttttaagtcagtgcttagaccag
ctgaaagaggacatggaaaagttaaataaaacttggaagactgaacctgttcccggagaa
gaaaattcttcagatatttcggccaccagggtgtacacttgtcctgttattactaacttg
gagtttgaggttcagcactccatcatctgtaaagcatgtggagagattattcccaaaaga
gaacagtttaatgacctctccattgaccttcctcgaaggaaaaagccactccctcctcgt
tcaattcaagattctcttgatcttttctttagggcagaagaacttgagtattcctgtgag
aagtgtggtgggaagtgtgctcttgtcaggcacaaatttaacaggctacccaggatcctt
attcttcatttgaaacgatacagtttcaatgtcactctctcacttaacaacaagattggg
cagcaagtcatcattccaagatacctgaccctgtcctctcattgcactgaaaatacaaaa
ccacccttcacccttggttggagtgcacatatggcaatttctagaccattgaaagcctct
caaatggtgaattcctgcatcaccagcccttctacaccttcaaagaatttcaccttcaaa
tccaagagctccttggctttatgccttgattcagacagtgaggatgagctaaaacgctct
gtggcccttagccagagactttgtgaaatgtcaggctgcgaacagcagcaggaagacctg
gaaaaagattcaaaatcatgtaggatagagcctgataagtccgaattggaaaactccgga
tttgacggaatgagcgaagaagagcttctagcagctgttttagagatgagtaagagagaa
tcttcaccaactctgagtcatgaagatgatgataaaccaaccagcagcccagatactgga
tttgcagaagatgatattcaagaaatgcctgaaaatcaagaacctgtggaaactgagaag
cccaaaacagtcacagagcccgattctgccagttttacggagataactaaagactgtgat
gagaataaagaaaacaaaactccagaaggatctcaaggagaggtcgattggctccagcag
tatgatatggagcgtgaaagggaagagcaagagcttcagcaggcattggctcagagcctt
caagagcaagaagcttgggaacagaaagaagatgatgacctcaaaagagcaacagagtta
agtcttcaagagtttaacaactcttttctggattcgttgggttccgatgaggactctggc
aatgaggatgttttagacatggagtacacagaagccgaagcggaggaactgaaaagaaat
gcagagacaggaaatcttcctcattcttatcggctcatcagtgttgtcagtcacattggt
agcacctcttcttcaggtcattacattagtgatgtgtacgacattaagaagcaggcatgg
tttacttacaatgatctcgaggtatctaaaatccaagaggcttccgtgcagagcgatcgg
gaccggagtggttatatcttcttttatatgcacaaggagatctttgatgagctgctggaa
acggaaaagaattctcaggcacttagcatggaagtggggaagaccacccgtcaggccttg
tga

DBGET integrated database retrieval system