KEGG   Ailuropoda melanoleuca (giant panda): 100481522Help
Entry
100481522         CDS       T01329                                 

Definition
NADH-cytochrome b5 reductase 1-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100481522
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     100481522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 305 aa AA seqDB search
MGFQPSPVLLASLGVGLLTLLSLALGSYLIRRSRRPKVTLLDPNEKYLLRLLDKTTVSHN
TKRFRFALPTAHHILGLPVGKHVYLSARIDGGLVIRPYTPVTSDEDQGYVDLVIKIYLKG
VHPKFPEGGKMSQYLNSLKIGDVVEFRGPSGLLTYTGKGNFSIQPNKKSPPEPQVAKKLG
MIAGGTGITPMLQLIQAILKDPEDPTQCSLLFANQTEKDIILREDLEELQARYPSRFKLW
FTLDHPPEDWAYSKGFVTADMIREHLPAPGDDVLLLLCGPPPMVQLACHPNLDKLGYSQK
MRFTY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgggcttccagccgagccctgtcctgctggcctccttgggggtggggctgctgactctg
ctcagcctggctttgggctcctacttgattcggaggtcccgccggccaaaggtcactctc
ctggaccccaatgagaaatacctgctgcgacttctagacaagacgactgtgagccacaac
accaagaggttccgctttgccctgcccaccgcccaccacattctggggctgcctgtgggc
aaacatgtctacctttctgcccggatcgatggcggcctggtcatcaggccatacactcct
gtcaccagtgatgaggaccaaggctacgtggatcttgtcatcaagatctacctgaagggc
gtgcaccccaaatttcctgagggaggaaagatgtctcagtacctgaatagcctgaagatt
ggggatgtggtggagtttcgagggccaagtgggctgctcacttacactggaaaagggaat
tttagcattcagcccaacaaaaaatctccaccagagccccaggtagcaaagaaactgggg
atgattgccggcggaacaggaatcactccgatgctacagctgatccaggccatcctgaaa
gaccctgaagatccaacccagtgctctctgctttttgccaaccagactgaaaaggacata
atcttgcgggaggacctggaggagctgcaggcccgataccccagtcgctttaagctttgg
ttcactctggatcaccccccagaagactgggcctacagcaagggctttgtgacggccgac
atgatccgggagcatctgcccgccccaggggacgacgtgctgctgctgctctgtgggcca
cccccgatggtgcagctggcctgccatcccaacttggacaaactgggctactcacagaag
atgcgattcacctactga

DBGET integrated database retrieval system