KEGG   Ailuropoda melanoleuca (giant panda): 100481682Help
Entry
100481682         CDS       T01329                                 

Definition
glutathione peroxidase 1-like
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100481682
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100481682
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    100481682
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100481682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 220 aa AA seqDB search
MRVLNPNNRHWALQPARAVAPRALVQAFSASVLAGGERGSLASLRDKVLXMENAASLXGA
XVWDSAQMNQLRQGLGLXRLVVLGFPSNQFLHQENARNQEILKPLKYVRPGGWFEPTLML
FDKCEVNGAQAHPXLRLPAETLPAPSDAATAVRTDLRFITWSPVCRNNVSWNLEKFQXGP
IGVPVGKYSCXFXPTEGEPDIQGIGLSQEPSCAFRRPSDP
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagggtgttaaatcctaacaatagacactgggccctacagccggccagggctgtggcc
ccccgcgctttggtgcaggccttctctgctagcgtcctggccggcggggagcgggggagt
ctggcgtccctgcgggacaaggtgctgntcatggagaatgcggcctcgctctgaggcgca
taggtctgggactccgcccagatgaaccagctgcggcagggcctcgggctctagagactg
gtcgttctcggattcccgagcaaccagttcctgcatcaggagaacgccagaaaccaagaa
atcctgaaacccctcaagtacgtccgacccggcggctggttcgagcccaccttgatgctt
tttgacaagtgcgaggtgaacggcgcgcaggcacaccccnntcttcgccttcctgcagag
actttgcctgctccaagtgacgccgccactgcggtcaggaccgacctcaggttcatcacc
tggtctcccgtgtgccgcaacaacgtctcctggaacttagagaagttccagngtggccca
attggtgtgcctgtggggaagtacagctgctgattctaaccaacagagggcgagcctgac
atccaagggatcgggctgtcccaggagcccagctgtgccttccggcgcccttccgatccc
taa

DBGET integrated database retrieval system