KEGG   Ailuropoda melanoleuca (giant panda): 100481692Help
Entry
100481692         CDS       T01329                                 

Definition
probable histone acetyltransferase MYST1-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100481692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 432 aa AA seqDB search
MLGEVKSPAPSPGRVSPPTPARGEPEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGR
EEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKH
DEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPK
LWLCEYCLKYMKFEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGRDHKIYCQNLCLL
AKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRR
GYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLS
QMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWA
PPKHKQVKLSKK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgttgggtgaagtcaaaagccccgccccgtccccgggccgcgtctctcccccgaccccg
gcgcgcggcgagccggaagtcaccgtggagatcggagaaacgtacctgtgccgacgcccg
gacagcacctggcattctgctgaagtgattcagtctcgagtgaacgatcaggagggccga
gaggaattctatgtacactacgtgggctttaaccggcgactggacgaatgggtagacaag
aaccggctggcgctgaccaagacagtgaaagacgccgtgcagaagaactccgagaagtac
ctgagcgagctggccgagcagcctgagcgcaagatcactcgcaaccaaaagcgcaagcat
gacgagatcaaccatgtgcagaagacctatgcagagatggaccccaccacagcagccttg
gaaaaggaacacgaggcgatcaccaaggtgaagtacgtggacaagatccacatcgggaac
tatgaaatcgatgcctggtacttctcaccgttccccgaggactatgggaaacagcccaag
ctatggctctgcgagtactgcctcaagtacatgaaattcgagaagagctaccgcttccac
ttgggccagtgtcagtggcggcagccccccgggaaggagatctaccggaagagcaacatc
tccgtgtacgaggtcgacggcagagaccacaagatttactgtcagaacctgtgtctgctg
gccaagcttttcctggaccataagaccttgtacttcgacgtggagcccttcgtcttttac
atcttgaccgaggtggacaggcagggggcccacatcgttggctacttctctaaggagaag
gagtctccggatgggaacaacgtggcctgcatcctgactctgcccccctaccagcgccgt
ggctatggaaagttcctcattgctttcagttacgagctctccaagctagaaagcacagta
ggctcccccgagaagccgctgtcggacctgggcaagctcagctaccgcagttactggtct
tgggtcctgctggagatcctgcgagacttccggggcacactgtccatcaaggacctcagc
cagatgaccagcatcacccagaatgacatcatcagcaccctacagtccctcaacatggtc
aagtactggaagggccagcatgtgatctgtgtcacacccaagctcgtagaagaacacctc
aaaagcgcccagtataagaaaccacccataacagtggactcggtctgtctcaagtgggca
ccccccaagcacaagcaagtcaaactctccaagaagtga

DBGET integrated database retrieval system