KEGG   Ailuropoda melanoleuca (giant panda): 100481692Help
Entry
100481692         CDS       T01329                                 

Gene name
KAT8
Definition
(RefSeq) K(lysine) acetyltransferase 8
  KO
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100481692 (KAT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 456 aa AA seqDB search
MGSAEVGVNSRLKALTPGNRGGRSGSPRYRAPPRPRAASLPRPRRAASRKXTVEIGETYL
CRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKN
SEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKI
HIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKFEKSYRFHLGQCQWRQPPGKEIYR
KSNISVYEVDGRDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYF
SKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYR
SYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLV
EEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcgcagaggtgggtgttaattccaggctcaaagccctaacgccaggcaaccgg
ggaggccgctctggctcgccccggtaccgggccccgccccgtccccgggccgcgtctctc
ccccgaccccggcgcgcggcgagccggaagntcaccgtggagatcggagaaacgtacctg
tgccgacgcccggacagcacctggcattctgctgaagtgattcagtctcgagtgaacgat
caggagggccgagaggaattctatgtacactacgtgggctttaaccggcgactggacgaa
tgggtagacaagaaccggctggcgctgaccaagacagtgaaagacgccgtgcagaagaac
tccgagaagtacctgagcgagctggccgagcagcctgagcgcaagatcactcgcaaccaa
aagcgcaagcatgacgagatcaaccatgtgcagaagacctatgcagagatggaccccacc
acagcagccttggaaaaggaacacgaggcgatcaccaaggtgaagtacgtggacaagatc
cacatcgggaactatgaaatcgatgcctggtacttctcaccgttccccgaggactatggg
aaacagcccaagctatggctctgcgagtactgcctcaagtacatgaaattcgagaagagc
taccgcttccacttgggccagtgtcagtggcggcagccccccgggaaggagatctaccgg
aagagcaacatctccgtgtacgaggtcgacggcagagaccacaagatttactgtcagaac
ctgtgtctgctggccaagcttttcctggaccataagaccttgtacttcgacgtggagccc
ttcgtcttttacatcttgaccgaggtggacaggcagggggcccacatcgttggctacttc
tctaaggagaaggagtctccggatgggaacaacgtggcctgcatcctgactctgcccccc
taccagcgccgtggctatggaaagttcctcattgctttcagttacgagctctccaagcta
gaaagcacagtaggctcccccgagaagccgctgtcggacctgggcaagctcagctaccgc
agttactggtcttgggtcctgctggagatcctgcgagacttccggggcacactgtccatc
aaggacctcagccagatgaccagcatcacccagaatgacatcatcagcaccctacagtcc
ctcaacatggtcaagtactggaagggccagcatgtgatctgtgtcacacccaagctcgta
gaagaacacctcaaaagcgcccagtataagaaaccacccataacagtggactcggtctgt
ctcaagtgggcaccccccaagcacaagcaagtcaaactctccaagaagtga

DBGET integrated database retrieval system