KEGG   Ailuropoda melanoleuca (giant panda): 100481722Help
Entry
100481722         CDS       T01329                                 

Gene name
CHP1
Definition
(RefSeq) calcineurin like EF-hand protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100481722 (CHP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_5 SPARC_Ca_bdg RST
Motif
Other DBs
NCBI-GeneID: 100481722
NCBI-ProteinID: XP_002913257
Ensembl: ENSAMEG00000016786
UniProt: G1MEF2
Position
Un
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggtctcgggcttccacgttattgcgggacgaagagctcgaggagatcaagaaggag
actggcttttcccacagtcagatcactcgcctctacagccgcttcaccagcctggacaaa
ggagagaacgggactctcagccgggaagatttccagcgaattccggaacttgctatcaac
ccactgggggaccggatcatcaatgccttctttccagagggagaggaccaggtaaacttc
cgtggattcatgagaactttggctcattttcgacccattgaggataatgaaaagagcaaa
gatgtgaatggaccagaaccactcaatagccgaagcaacaaactgcactttgcttttcga
ctctatgacttggataaagatgacaagatttcccgtgatgagctgttacaggtgctacgt
atgatggttggagtaaatatctcagatgagcagctgggcagcatcgcagacaggaccatc
caggaagctgatcaggatggggacagcgccatatctttcacagaatttgttaaggttttg
gagaaggtggatgtagaacagaaaatgagcattcgatttcttcactga

DBGET integrated database retrieval system