KEGG   Ailuropoda melanoleuca (giant panda): 100481722Help
Entry
100481722         CDS       T01329                                 

Definition
calcium-binding protein p22-like
Orthology
K17610  
calcineurin B homologous protein 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggtctcgggcttccacgttattgcgggacgaagagctcgaggagatcaagaaggag
actggcttttcccacagtcagatcactcgcctctacagccgcttcaccagcctggacaaa
ggagagaacgggactctcagccgggaagatttccagcgaattccggaacttgctatcaac
ccactgggggaccggatcatcaatgccttctttccagagggagaggaccaggtaaacttc
cgtggattcatgagaactttggctcattttcgacccattgaggataatgaaaagagcaaa
gatgtgaatggaccagaaccactcaatagccgaagcaacaaactgcactttgcttttcga
ctctatgacttggataaagatgacaagatttcccgtgatgagctgttacaggtgctacgt
atgatggttggagtaaatatctcagatgagcagctgggcagcatcgcagacaggaccatc
caggaagctgatcaggatggggacagcgccatatctttcacagaatttgttaaggttttg
gagaaggtggatgtagaacagaaaatgagcattcgatttcttcactga

DBGET integrated database retrieval system