KEGG   Ailuropoda melanoleuca (giant panda): 100481840Help
Entry
100481840         CDS       T01329                                 

Gene name
PRLR
Definition
(RefSeq) prolactin receptor
  KO
K05081  
prolactin receptor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100481840 (PRLR)
   04151 PI3K-Akt signaling pathway
    100481840 (PRLR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100481840 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    100481840 (PRLR)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    100481840 (PRLR)
Cytokine receptors [BR:aml04050]
 Class I cytokine receptor (hematopoietin family receptor)
  100481840 (PRLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 716 aa AA seqDB search
MTPGGRIFASMCAWMLLSQAIQPCYIFLHSSPPVLSFTLSKEQGSVANTQNKVVHVPGQT
RLTSQKLPGAFSFSECLIHFLWEEKGAKMKESVVSTVVFILLLFLNTSLLNGQSPPGKPE
IFKCRSPEKETFTCWWKPGEDGGLPTNYTLTYRKEGETTTHECPDYITNGPNSCHFNKKH
TSIWTMYIITINATNQMGSSSSDPRYVDVTYIVEPDPPVNLTLELKQPEDKKPYLWMKWY
PPTLVDVRSGWLTLQYEIRLKPKKATEWETHFAGQQTQFKILSLYPGQKYLVQVRCKPDH
GFWSEWSPESSIQIPNDVTMKDTIVWIFVAVLSAVICLIMVAAVALKGHSMVTCILPPVP
GPKIKGFDTHLLEKGKSEELLSALGCQDFPPTSDCEDLLVEFLEVDDSEDQQLMPAHSKE
HPGRDTKPAPLDPDSDSGRGSCDSPSLLSKKCEEARVSPSTFHTPEGIEKPENPPAKVTR
TRDPQSTRLEGKIPYFPADGSKSSTWPLPQPPSQHSPRSSYHSIAEVCKLAMGTGGASAT
PLDKTDTHALRSPKTTEPGGEEEAAERREVESFCSKTDQGTAWLLPQEKSPFISVKPLDY
VEIHKVNRDGALSLLPKQKENSNQAEKPCAPETSKEYAKVSRVMDDNILVLVRDPQAQSL
AAFEEPDKEAPPSLPQNPAGEDLAAFASAPSGCGLQLGNTTEYRKRTLLENARECG
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgacccctggtggtagaatttttgctagcatgtgtgcatggatgcttctgagccaagcc
atccaaccatgttacattttcctacattcctctcctcctgttttgtcattcacattaagc
aaggagcaaggatcagttgcaaacacccagaataaagtggtgcatgtgcctggccagact
agacttacttcacaaaagttgcccggtgccttctctttcagtgaatgtctgatacatttc
ctgtgggaagagaaaggggccaaaatgaaggaaagtgtggtatccacagttgttttcatt
ttgctactttttctcaacaccagtctcctgaatggacaatcacctcctggaaaacctgag
atctttaaatgtcgttctcctgaaaaggaaacattcacctgctggtggaagcctggggaa
gatgggggacttcctactaattacacgctgacgtaccgcaaggaaggagagacaaccaca
catgaatgtccagactacataaccaatggccccaattcctgtcacttcaacaagaagcac
acctccatatggacaatgtacatcatcacaataaatgccacaaaccagatgggaagcagt
tcctcggatccacgttatgtggacgtgacttacatagttgaaccagaccctcctgtgaac
ctaactttggaattaaaacagccagaagacaaaaaaccgtatctgtggatgaaatggtac
ccacccaccctggttgatgttagatctggttggctcacactccagtatgaaattcggtta
aaacccaagaaagcaactgagtgggagactcattttgctgggcagcagactcagtttaag
attctcagcttatatccaggacagaaataccttgtccaggttcgctgcaagccagaccat
ggattctggagtgagtggagcccagagagctctatccagatacctaatgatgtcaccatg
aaagataccatcgtgtggatctttgtggccgttctttctgctgtcatctgtctgattatg
gtcgcagcagtggctttgaaaggccatagcatggtgacctgcatccttccaccagttcct
gggccaaaaataaagggatttgatactcatctgctggagaagggcaagtctgaagaactg
ctgagcgccctggggtgccaagacttccctcccacttcggactgtgaggacttgctggtg
gagtttttagaagtggatgacagcgaggaccaacagctgatgccagcccattcgaaagaa
cacccgggtcgagatacgaagcccgcgcccctggatccagacagtgactctggccggggc
agctgcgacagcccttcccttctgtctaaaaagtgtgaggaagcccgggtgagtccctcc
acatttcacactcctgagggcatcgagaagccagagaatcccccagcaaaggtcacccgc
actcgggacccccagagcacacgcctggaaggcaaaatcccctatttccctgccgacgga
tccaaatcttcaacgtggcctttaccgcagccccccagccagcacagccccagatcttct
taccacagcatcgctgaggtgtgtaagctggccatgggcacagggggggcctcggccact
ccgctggacaaaacagacacacatgctttaagatctccaaaaaccaccgagcctggaggg
gaggaagaggcagctgagcggagggaagtggaaagcttctgttccaagactgaccaaggc
acagcatggctgttgccccaggagaaaagccctttcatctctgtgaaacccttggattat
gtggagattcacaaggtgaacagagatggagcgctatccctgctcccaaaacagaaagag
aacagcaaccaggctgagaagccctgtgctcctgaaaccagtaaggagtacgctaaggtg
tccagggtgatggatgacaacatcctggtgttggtgcgggatccgcaagctcagagcctg
gctgcgtttgaagaaccagacaaggaggccccgccgtccctgccacagaatccagcggga
gaagacctggccgccttcgcctcggccccaagcggctgcggactccagttgggtaacact
acagagtacaggaaacgcactctactagagaatgctcgagaatgtggttag

DBGET integrated database retrieval system