KEGG   Ailuropoda melanoleuca (giant panda): 100481872Help
Entry
100481872         CDS       T01329                                 

Definition
galactocerebrosidase-like
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100481872
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100481872
Enzymes [BR:aml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     100481872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 683 aa AA seqDB search
MAERLLQASRQRRGKAMTAAVGGRAAVPLLLCALLVPGGAYVLDDSDGLGREFDGIGAVS
GGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALD
ENYFRGYEWWLMKEAKKRNPNITLMGLPWSFPGWLGKHFNWPYVNLQLTAYYVMTWIVGA
KHYHDLDIDYIGIWNERSFDINYIKVLRRMLNYQGLDRVKIIASDNLWEPISASMLLDSE
LMAVIDVIGAHYPGTHTVKDAKLTNKKLWSSEDFSTLNSDVGAGCLGRILNQNYINGYMT
ATIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPIWVSAHTTQFTQPGWYYLKTVG
HLEKGGSYVALTDGLGNLTIIVETMSHKYSTCIRPFLPYYNVSHQFATFVLKGSFSEIPE
LHVWYTRLGKPSTRFLFKQLDSLWLLDSRGTFTLELREDELFTLTTLTTGGKGSYPLPPK
SQPFPRIYKDDFDVDYPFFSEAPNFADQTGVFEYFTNIEDPGEHRFTLRQVLNQRPITWA
ADASNTISIIGDYKWSNLTVTCDVYIETPEKGGVFIAGRVNKGGILIRSARGVFFWIFAN
GTYRVTGDLAGWIIYALGHVDVTAKKWYTLTLIIKGRLSSGMLNGSYVWTNIPVSFPKNG
WAAIGTRSFEFAQFDNFRVEATS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcgcctactccaggcttcccggcaacgccgagggaaagccatgacggccgcc
gttgggggccgcgccgcggtgcccctactactgtgcgcgctgctggtgcccggcggcgcg
tacgtgctggacgactccgacgggctgggccgggagttcgatggcatcggcgcggttagc
ggcggcggggcaacctcccgacttctagtaaattatccagagccctatcgttctcaaata
ttggattatctctttaagccaaacttcggtgcctctttgcatattctgaaagtcgaaata
ggtggtgatgggcagacaacagatggtactgaaccctcccacatgcactatgcattagat
gagaattatttccgaggatatgagtggtggttaatgaaggaagctaagaagcggaaccct
aatattacactcatggggttgccttggtcgttccctggatggctaggaaaacatttcaat
tggccttatgtgaatcttcagctgactgcctactatgtcatgacctggattgtgggcgcg
aagcattatcatgatttggatattgattatattgggatttggaatgagaggtcatttgac
atcaattatatcaaggtgttaagaagaatgttgaactatcaaggtctcgatcgagtgaaa
atcatagcgagtgacaatctctgggagcctatttctgcttctatgttgcttgactctgag
ctcatggcggtgattgatgttataggagctcattatcctgggacccatacagtaaaggat
gcaaagttgactaacaagaagctttggtcttctgaagattttagcactttaaacagtgat
gtgggtgcaggctgcttgggccgcatattgaatcagaattatatcaatggctacatgact
gccacaattgcttggaacttggtggccagttactatgaacagttgccctatggacggtgt
ggcttgatgactgctcaggagccatggagcgggcactatgtagtagagtctcctatctgg
gtatcagctcataccactcagtttactcaaccaggttggtattacctgaagacagttggt
cacttagagaaaggaggaagctacgtggccctgactgatggcctaggtaacctcaccatc
atcgttgaaactatgagccataaatattctacgtgtatacggccgtttctgccttactac
aatgtgtcacatcagtttgctacctttgttcttaaaggttcttttagtgaaataccagag
ttacatgtgtggtatacgaggcttggaaaaccatctacgagatttctttttaaacaactg
gattctctatggctcctcgacagcaggggcactttcaccctggagctgcgggaggacgag
ctcttcacgctcaccactctcaccaccgggggcaagggcagctacccgctgcctccgaag
tcccagcccttcccaagaatttataaagacgatttcgatgttgattacccgttttttagt
gaagctccgaatttcgctgatcagactggtgtctttgaatactttacgaatattgaagac
cctggagagcatcgcttcacacttcgccaagttctcaatcagcggcccattacttgggct
gctgatgcgtccaacaccatcagtattataggagattacaaatggtccaatctgactgta
acgtgtgatgtttacatagagactcctgagaagggaggtgtgttcattgctggaagagta
aacaaaggtggcatcttgattagaagcgccagaggagttttcttctggatttttgcaaat
ggaacctacagagttacaggtgatctagccggatggatcatatatgctttaggacatgtt
gatgttacagcaaaaaaatggtatacactcacattaattattaagggccggctctcctct
ggcatgctgaacggcagctacgtctggacgaacatccctgtgagtttcccgaagaacggc
tgggccgccattggaacgcgctcctttgaatttgcgcagtttgacaactttcgtgtggaa
gccacaagctga

DBGET integrated database retrieval system