KEGG   Ailuropoda melanoleuca (giant panda): 100481994Help
Entry
100481994         CDS       T01329                                 

Gene name
PLCG2
Definition
phospholipase C, gamma 2 (phosphatidylinositol-specific)
Orthology
K05859  
phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Ras signaling pathway
Calcium signaling pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Osteoclast differentiation
Platelet activation
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
Thyroid hormone signaling pathway
Epstein-Barr virus infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100481994 (PLCG2)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100481994 (PLCG2)
   04012 ErbB signaling pathway
    100481994 (PLCG2)
   04370 VEGF signaling pathway
    100481994 (PLCG2)
   04064 NF-kappa B signaling pathway
    100481994 (PLCG2)
   04066 HIF-1 signaling pathway
    100481994 (PLCG2)
   04020 Calcium signaling pathway
    100481994 (PLCG2)
   04070 Phosphatidylinositol signaling system
    100481994 (PLCG2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100481994 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    100481994 (PLCG2)
   04662 B cell receptor signaling pathway
    100481994 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    100481994 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    100481994 (PLCG2)
   04670 Leukocyte transendothelial migration
    100481994 (PLCG2)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100481994 (PLCG2)
  Nervous system
   04722 Neurotrophin signaling pathway
    100481994 (PLCG2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100481994 (PLCG2)
  Development
   04380 Osteoclast differentiation
    100481994 (PLCG2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100481994 (PLCG2)
   05206 MicroRNAs in cancer
    100481994 (PLCG2)
   05205 Proteoglycans in cancer
    100481994 (PLCG2)
   05214 Glioma
    100481994 (PLCG2)
   05223 Non-small cell lung cancer
    100481994 (PLCG2)
  Infectious diseases
   05169 Epstein-Barr virus infection
    100481994 (PLCG2)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100481994 (PLCG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1265 aa AA seqDB search
MTALVNVDTLPEYEKSQIKRALELGTVMTVFSFRKCTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTVLYGTQFVLSTLSLAADSKEDAT
KWLSGLKILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVNSA
KFLKDKFVEIGAHKDELSFEQFHLFYKNLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VYLHDFQRFLLHEQQELWAQDLTKVRERMTKFIHDTVRETAEPFLFVDEFLTYLFSRENS
IWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYVRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCCVEQQRHMARV
FKEVFGDQLLMKPTEASADQLPSPSQLRERIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTAEEELPQDIPPMELHFGEEWFHKKVEKR
ASAEKLLQEYCAETGGKDGTFLVRESKTFPNDYTLSFWRSGRVQHCRIRSTMEGGTMKYF
LTDNITFTSIYALIQHYRETHLRCTEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDML
MRVPRDGAFLIRRREGTDSYAITFRARGKVKHCRIHRDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELSFCRGALIHNVSKEPWGWWKGDYGTRIQQYFPSNYVEDISTFDGEEMEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKQFVFILEPKKQGDPPVEFATDKVEELFEWF
QSIREITWKMDTKENNMKYWEKNQSIAIELSDLVIYCKPTSKTKDNLENPDFREIRSFVE
TKADSVVRQKPIDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
MQMNHALFSLNGRTGYVLQPESMRSEKYDPIPPESQRKILMTLSVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAATQEKVTFEIYDPSLAFLRFVVYEED
MFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMQPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQLYQEKCNRRLREKRVSN
SRFYS
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccctggtcaacgtggacacccttcctgagtacgagaagagtcagatcaagaga
gcgctggagctgggcacggtgatgacggtgttcagtttccgcaagtgcaccccagagcgg
aggaccgtccaggtgatcatggagacgcgccaggtggcctggagcaagacagccgacaag
atcgagggcttcttggatatcatggaaatcaaggaaatccgcccagggaagaactccaag
gattttgagcgtgccaaagctgtccgccagaaggaagactgctgctttaccgtcctgtac
ggcacccagtttgttctcagcacgctcagtttggcagccgactccaaagaagatgcgact
aagtggctgtctggcttgaaaatcttacaccaggaagcgatgagcgcctccacacccacc
attattgagagttggctgagaaagcagatttattcagtggatcaaaccagaagaaacagc
atcagcctccgagagttgaaaaccatcttacccctggtcaacttcaaagtgaacagtgcc
aagttcctcaaagataagtttgtggaaatcggcgcgcacaaagatgaactcagcttcgag
cagttccacctgttctacaaaaaccttatgtttgagcaacaaaagtcgattcttgacgaa
ttcaaaaaagattcttccgtgttcatcttgggcaacaccgaccggccggatgcctccgct
gtttacctgcacgacttccagcgctttctcttacacgagcagcaggagctttgggctcag
gatctgaccaaagtccgtgagcggatgactaagtttatccacgacaccgtgagggaaact
gctgagcccttcttatttgtcgatgagttcctcacatacctgttctcgcgggagaacagc
atctgggatgagaagtacgacgtggtggacatgcaggacatgaacaaccccttgtcgcat
tactggatctcctcttcgcataacacgtacctcaccggtgaccaactgcggagcgagtca
tctacggaagcgtacgtccgctgcctgcggatgggctgtcgctgcattgagctggactgc
tgggacgggcctgatgggaagcccatcatctaccacggctggacacggaccaccaagatc
aagtttgatgatgtcgtgcaggccatcaaagaccatgcatttgtcacttcaagcttcccg
gtgatcctgtccatcgaggagcactgttgcgtggaacagcagcgccacatggccagggtg
ttcaaggaggtgtttggcgaccagctgctgatgaagcccacggaggccagtgctgaccag
ctgccctcgcccagccagctgcgggagaggataatcatcaagcataagaagctgggcccc
cgaggtgacgtggatgtcaacatggaggataagaaagatgagcacaaacaacagggtgaa
ctgtacatgtgggattccatcgaccagaagtggactcggcactactgtgccatcgctgat
gccaagctgtcgttcagcgatgacattgaacagactgcagaagaggagctgccccaggat
ataccccctatggagctgcactttggggaggagtggttccacaagaaggtggagaagagg
gcaagtgccgagaagctgctgcaggaatactgtgcggagacggggggcaaggatgggacc
ttcctggtgcgggagagcaagaccttccccaacgactacactctgtccttctggcggtcc
ggccgggtccagcactgccggatccgttccaccatggagggcgggaccatgaagtacttc
ctgactgacaacatcacgttcaccagcatctatgccctcatccagcactaccgcgagacg
cacctgcgctgcacggagttcgagctccggctcaccgaccctgtgcccaaccccaacccc
cacgagtcaaagccgtggtactatgacgggctgagccgcggggaagcggaggacatgctc
atgagggttccccgggacggcgccttcctgatccggaggcgggagggcaccgactcctac
gccatcaccttcagggccaggggcaaggtaaagcactgtcgcattcaccgggacggccgg
cactttgtgctggggacctcggcctacttcgagagcctcgtggagctcgtcagctactac
gagaagcatgcgctctaccggaagatgcggctgcgctaccccgtgacgccggagctcctg
gagcgctacaatatggaaagagacataaactccctctatgacgtcagcaggatgtatgtg
gatcccagcgaaatcaatccttccatgcctcagagaaccgtgaaagctctgtatgactac
aaagccaagcgaagtgatgagctgagcttctgccgtggggccctcattcacaacgtctcc
aaggaaccctggggctggtggaaaggagactatgggaccagaatccagcagtacttccca
tccaattatgtcgaggacatttcaacattcgacggggaggagatggagaagcagattatt
gaagacaatcccttagggtctctttgtaggggaatattggatctcaacacctataacgtc
gtgaaagccccccaggggaaaaaccagaaacagttcgtgtttatcctggagcccaagaag
caaggcgaccccccagtcgagtttgccacggacaaggtggaggagctctttgagtggttc
cagagcatccgggagatcacctggaagatggacaccaaggagaacaacatgaaatactgg
gagaagaaccagtccatcgccattgagctctcggacctggtgatttactgcaagccgacc
agcaagaccaaggacaatctagaaaaccccgacttccgagaaatccgctcctttgtggag
acgaaggcggacagtgtcgtcaggcagaaacccattgacctcctgaagtacaatcagaag
ggcctgacccgtgtttacccaaagggacagagggtggactcctccaactacgaccccttt
cgcctctggctgtgtggctcccagatggtggcactcaacttccagacgccagacaagtac
atgcagatgaatcacgccttgttctcactcaacgggcggacgggctacgtcctccagcct
gagagcatgaggtccgagaagtacgaccccataccaccggagtcccagaggaagatcctg
atgactctgtcagtcaaggttcttggggctcgccatctccccaagcttggacgaagtatt
gcgtgtccctttgtggaggtggaaatctgtggagctgaatatgacaacaacaagtttaag
acaacagttgtgaatgacaatggcctaagtcctgtttgggctgcaacacaggagaaagtg
acctttgaaatttatgaccccagcctggcatttctgcgttttgtggtctacgaggaagat
atgttcagtgatcccaatttcctggcccacgccacttaccccatcaaaggaatcaaatca
ggattcagatctgttcctctgaagaacgggtacagcgaagacatcgagctggcttccctc
ctggttttctgtgagatgcagccagtcctggagagcgaagaggagctgtattcgtcctgc
cgccagctgcgacggcggcaggaagaactgaacaaccagctcttcctgtacgacacgcac
cagaacttacgtaacgccaaccgggatgccctcgtgaaagagttcaacgtcaatgagaac
cagctccagctctatcaggagaagtgcaaccggaggttgagagagaagagagtgagcaac
agcaggttttactcctag

DBGET integrated database retrieval system