KEGG   Ailuropoda melanoleuca (giant panda): 100482031Help
Entry
100482031         CDS       T01329                                 

Gene name
KAT2B
Definition
(RefSeq) lysine acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100482031 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100482031 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100482031 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    100482031 (KAT2B)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100482031 (KAT2B)
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100482031 (KAT2B)
Chromosome [BR:aml03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100482031 (KAT2B)
   HAT complexes
    PCAF complex
     100482031 (KAT2B)
    STAGA complex
     100482031 (KAT2B)
    TFTC complex
     100482031 (KAT2B)
    SAGA complex
     100482031 (KAT2B)
    SLIK complex
     100482031 (KAT2B)
    ADA-HAT complex
     100482031 (KAT2B)
    HAT-A2 complex
     100482031 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 827 aa AA seqDB search
MASGLLVLYRSCGLGGEETLTHLPCISPACCKQGQVPRFQIPTTKLQGPLLNFDVKIINP
AGASLPSDAVFSIYWSFSTAVECLCLPFFPHRSHPHAEESCKCNGWKNPNPSPTPPRADL
QQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQ
VYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPSKERQTIV
ELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTQ
VFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIW
DQDFLSASSRTSQLGIQTVISPPPVAGTISYNSNSSSLEQPNGGSTSPSCKGSSGLEANP
GEKRKMNDSHAMEEAKKPRVMGDIPMELIDEVMSTITDPAAMLRPETNLLSAHSARDEAA
RLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKT
LALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNF
LTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKK
QKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPKDP
DQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSK
KLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggcttgttggtgctttacagaagctgtgggcttggcggggaagagacactc
acacacctcccatgtatatctccggcctgctgcaaacagggtcaagttcccagattccag
attcccacaaccaagctgcaggggccacttctgaattttgatgtaaagattattaatcct
gctggagcctctctccccagtgatgccgtttttagtatttactggagcttctcaaccgca
gtggaatgtctgtgcttacccttttttccacaccgttcacatcctcacgccgaggagtct
tgtaaatgtaatggctggaaaaatcccaacccttctcccacgccccccagagctgacctg
cagcagatcattgtcagcctaacagaatcctgccggagctgtagccatgccctagctgct
catgtttcccacctggaaaatgtgtccgaggaagaaatgaacagactcctgggaatagtg
ttggatgtggaatatctctttacctgcgtccacaaggaagaagatgcagataccaaacaa
gtttatttctatctctttaagctcttgagaaagtctattttacaaagaggaaaacctgtg
gttgaaggctctttggagaagaaacccccatttgaaaaacctagtattgaacagggtgtg
aataactttgtacagtacaaatttagtcacctgccatccaaagaaaggcaaacaatagtt
gagttggcaaaaatgttcctaaaccgcatcaactattggcatctggaggcaccatctcaa
cgaagactgcgatctcccaatgatgatatttctggatacaaagagaactacacaaggtgg
ctgtgttactgcaacgtgccccagttctgtgacagtctacctcggtatgaaaccacccag
gtgtttgggagaacgctgctgcgctcagtcttcacagtcatgagacgacaactcctggaa
caagcgagacaggagaaagacaaactgccacttgaaaaacgaactctaatcctcacgcat
ttcccaaagtttctctccatgttagaagaagaagtgtatagtcaaaactctcctatctgg
gatcaggattttctctcagcctcttccagaaccagccagctaggaatccaaacagttatc
agcccacctcctgtagctgggaccatttcatataattcaaactcatcttcccttgagcaa
cctaatggagggagcaccagtccttcctgcaaaggctcttctgggcttgaggcaaaccca
ggagaaaagaggaaaatgaatgactctcatgccatggaggaggccaagaaaccccgagtt
atgggggatattccaatggaattaattgacgaggtcatgtctaccatcacagaccctgca
gcaatgctcagaccagagaccaatttactgtcagcacattcagcccgggatgaggcagca
aggctggaagagcgcaggggtgtgattgaatttcacgtggtcggcaattccctgaaccag
aaacccaacaagaagattctaatgtggctagtcggactacagaatgtgttctcacaccag
ctgccccggatgccaaaagagtacatcacacggcttgtctttgacccgaaacacaaaacc
cttgccctaattaaagatggccgtgttattggtggtatctgtttccgtatgttcccatcc
caaggattcacagagattgttttctgtgctgtaacctcaaatgagcaagtcaagggctat
ggaacacacctgatgaatcacttgaaagaatatcatataaaacatgatatcctgaacttc
ctcacatatgcagatgaatatgcaattggttatttcaagaaacagggtttctccaaagaa
attaaaatacctaaaaccaaatatgttggctacatcaaggattatgaaggggccacttta
atgggatgtgagttaaatccacggatcccatacacagaattttctgtcatcatcaagaag
caaaaggagatcattaaaaagctgatagaaagaaaacaagcccagattcgaaaagtatac
cctggactttcatgttttaaagatggagttcggcagattccaatagaaagcattcctgga
attagagagacaggctggaagccgagtggaaaagagaaaagtaaagagcccaaagaccct
gaccagctttacagcacactcaagagcatccttcagcaggtgaagagccatcaaagcgct
tggcccttcatggaacctgtgaagagaacagaagctccgggatattatgaagttataagg
ttccccatggatctgaaaaccatgagcgaacgcctcaagaataggtactacgtgtctaag
aaattattcatggcagacttacagcgagtctttaccaattgcaaagagtacaacccccct
gagagcgaatactacaaatgtgccaatatcctggagaaattcttcttcagtaaaattaag
gaagctggattaattgacaagtga

DBGET integrated database retrieval system