KEGG   Ailuropoda melanoleuca (giant panda): 100482093Help
Entry
100482093         CDS       T01329                                 

Definition
deoxycytidine kinase-like
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100482093
   00240 Pyrimidine metabolism
    100482093
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100482093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 260 aa AA seqDB search
MATPPKRSCPSPATGSEGTRIKKIAIEGNIASGKTTFVNILKQVCEDWEVVPEPVARWCN
VQNAQGDCEELTTSQESGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLACLDGKLKDAE
KPVLFFERSIYSDRYVFASNLYESECMNETEWTIYQDWHDWMNQQFGQSLVLDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDFLQEIPILTLDINE
DFKDKHDGLIEKVKEFLSTL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccaccgaagaggagctgcccatctcccgcgaccggttctgaggggacccgc
atcaagaaaattgccatcgaagggaacattgcttcagggaagacaacatttgtgaatatc
cttaaacaggtctgcgaagattgggaagtggttccggaacctgttgccaggtggtgcaat
gttcagaatgctcaaggtgactgtgaggaactgacgacgtctcaggaaagtggtggaaat
gttcttcagatgatgtacgaaaaacctgaacgatggtcttttacgttccagtcatatgcc
tgcctcagtcgaatacgagcccagcttgcctgtcttgatggcaagctcaaagatgcagag
aaacctgtattattttttgaacgatctatatatagtgacaggtatgtctttgcatctaat
ttgtatgaatctgaatgcatgaatgaaacagagtggacaatttatcaagactggcatgat
tggatgaatcaacagtttggccaaagccttgtactggatggaatcatttatcttcgagcc
actccagagaaatgcttgaataggatatatttacggggaagaaatgaagaacaaggcatt
cctcttgaatatttagagaagcttcactataaacatgagagctggctactgcatagaaca
ctgaaaaccaactttgattttctacaagaaatccctatcttaacactggatattaatgaa
gattttaaagataaacacgacggtctgattgaaaaggtcaaagaatttttgagcactttg
tga

DBGET integrated database retrieval system