KEGG   Ailuropoda melanoleuca (giant panda): 100482126Help
Entry
100482126         CDS       T01329                                 

Definition
acetylcholinesterase-like
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100482126
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    100482126
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100482126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 612 aa AA seqDB search
MRPPWCPLHTPSLTSPILLLLLFFLGGGAEAEDPELLVTVRGGRLRGIRLMAPGGPVSAF
LGIPFAEPPVGPRRFLPPEPKRPWSGVLDATVFQSVCYQYVDTLYPGFEGTEMWNPNREL
SEDCLYLNVWTPYPRPASPTPVLVWIYGGGFYSGASSLDVYDGRFLAQAEGTVLVSMNYR
VGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPMSVTLFGESAGAASVGMH
LLSPPSRALFHRAVLQSGAPNGPWATVGVGEAXRRRATLLARLVGCPPGGAGGNDTELVA
CLRTRPAQDLVDHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVGVV
KDEGSYFLVYGAPGFSKDNESLISRAQFLAGVRVGVPQASDLAAEAVVLHYTDWLHPEDP
ARLREAMSDVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLSWPLWMGVPHGYEI
EFIFGLPLEPSLNYTAEERTFAQRLMRYWANFARTGDPNDPRDPKVPQWPPYTAGAQQYV
SLNLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQF
DHYSKQDRCSDL
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccccctggtgtcccctgcacacgccctccctgacttccccaatccttctcctc
ctcctcttctttctgggaggaggggcagaggctgaggacccggagctgctggtgacggtg
cgtgggggccggctgcggggcatccgcctaatggcccctgggggccccgtctctgctttt
ctgggcatccccttcgcagagccacctgtgggcccccgtcgctttctgccgccggagccc
aagcggccctggtcaggggtgctggacgccacagtcttccaaagtgtctgctaccaatat
gtggacaccttgtaccccggctttgagggcaccgagatgtggaacccaaaccgtgagctc
agtgaggactgcctctacctcaatgtgtggacaccatacccccggcctgcatcccccacc
cctgtcctcgtctggatctacgggggtggcttctacagtggggcctcctccctggacgtg
tatgatggccgcttcctggcccaggctgaggggactgtgctggtgtccatgaactaccgg
gtgggagcctttggcttcttggccctgccaggaagccgggaagccccaggcaacgtgggt
ctactggatcagaggctggcactacagtgggtgcaggagaatgtggcagcctttgggggc
gaccccatgtcagtgactctgtttggggaaagtgccggtgctgcctcagtgggcatgcac
ttgctgtcccctcccagccgggccctgttccaccgggctgtgctgcagagcggtgcaccc
aacggcccctgggccacagtgggtgtgggagaggccncccgccgcagggccacactgctg
gcccgccttgtaggctgtcccccggggggtgctggtggcaatgacacagagctggtcgcc
tgcctgaggacacggccagctcaggacctggtggaccacgagtggcacgtgctgcctcag
gagagtgtcttccgcttctctttcgtgcctgtggtggatggagacttcctcagtgacaca
cccgaggccctcatcaatgctggagacttccacggtctgcaggtgctggtgggtgtggtg
aaggatgagggctcctattttctggtttacggggccccaggcttcagcaaagacaacgaa
tctctcatcagccgggcccagttcctggctggggtgcgggtcggggtcccccaggcgagt
gacctagctgccgaggctgtggtcctgcattacacagactggctgcaccctgaggacccg
gcacgcctgagagaggccatgagtgatgtcgtgggcgaccacaacgtcgtgtgccctgtg
gcccagctggctgggcgactggctgcccagggtgctcgggtctatgcttacatctttgaa
caccgcgcgtctacgctctcctggcccctctggatgggggtgccccatggctacgagatc
gagttcatctttgggctccctctggaaccctcgctaaactataccgccgaggagagaacc
tttgcccagcgactgatgagatactgggccaacttcgcccgcacaggggaccccaatgac
ccccgggaccccaaagtcccgcagtggccaccgtacacagcgggagcgcagcagtatgtg
agcctgaaccttcggccgctggaggtgcggcgggggctgcgcgcccaggcctgcgccttc
tggaaccgcttcctacccaaattgctcagcgccaccgacacgctggacgaggcggagcgc
cagtggaaggccgagttccaccgctggagctcctacatggtgcactggaagaaccagttt
gaccattacagcaagcaggatcgctgttcagacctgtga

DBGET integrated database retrieval system