KEGG   Ailuropoda melanoleuca (giant panda): 100482134Help
Entry
100482134         CDS       T01329                                 

Definition
ecto-ADP-ribosyltransferase 4-like
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100482134
Cellular antigens [BR:aml04090]
 Proteins
  100482134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 326 aa AA seqDB search
MKLQEQRSVCNTNEYRPLTTRGRRILPTTAAPGMRLWLQSGPLPLLMLFSALQTPIWSSE
VAVNIDFDLAPDSFNDQYQGCSPQVMEKLNQGDYFTKELKVHRNYHRVWANAHFTWLNQA
KNLPKNMTVTHAVAILVYTSNNSVRTDFTRAMASAGRSPQQYKHSFHFKYLHYYLTSAIQ
LLRKEMLMKNDSLCFEVHHEMKGIYLEAYRGAIIRFGQFLSTSRLKEAAQNFGNQTLFTI
FTCLGAPVQEVSLKEEVLVPPYEVFKVVNMSSHPRGNWLQLQSAGNVSTYNCQLLKGSSK
KYSPAPVVIASFSFLTSVVISSKTGV
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcaagagcagagaagcgtttgtaacaccaacgaataccgtccattgaccacc
agaggcaggaggattctcccgactactgcagcccccgggatgagactctggctccagtcg
gggccgcttcctctcctgatgctgttctcggcactgcagacacccatctggagttctgag
gtggcagttaacattgactttgacttggccccagattcctttaacgatcagtaccaaggc
tgcagcccacaggtcatggagaagctaaatcaaggggattattttacaaaagaactaaaa
gtacatagaaattaccacagggtctgggcaaatgcccacttcacctggctgaaccaagca
aaaaatctccccaagaacatgactgttacacacgctgtggccatcttggtttatacatca
aacaacagtgtccgcacagacttcactagagccatggccagtgctgggaggtctccacag
cagtataaacattcattccatttcaaatacctacactactacctgacctcagcaatccag
ctgctacggaaagaaatgctcatgaagaatgactctctgtgttttgaggtgcatcatgag
atgaagggtatctacttggaagcctacagaggtgccatcatccgatttggccaatttctc
tccacctcccgcttgaaagaagcagcacagaattttgggaaccaaactctatttaccata
tttacctgcctgggtgcccctgtacaagaagtctctctcaaggaggaggtcctggtccct
ccctatgaggtgttcaaagttgtaaacatgagctcccacccgagaggaaattggttgcag
ctgcagtcggctgggaacgtgagcacatataactgtcagctgctaaaaggttccagcaaa
aagtacagccctgctcctgtggttattgcttctttctcctttttgaccagtgtcgtcatc
tcttccaaaaccggagtataa

DBGET integrated database retrieval system