KEGG   Ailuropoda melanoleuca (giant panda): 100482335Help
Entry
100482335         CDS       T01329                                 

Definition
cytochrome P450 2J2-like
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100482335
   00591 Linoleic acid metabolism
    100482335
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100482335
  Nervous system
   04726 Serotonergic synapse
    100482335
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100482335
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100482335
Cytochrome P450 [BR:aml00199]
 Cytochrome P450, animal type
  CYP2 family
   100482335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 502 aa AA seqDB search
MLAAMGSLAAAVWAMGHLRTLLLGAVAFLFFADCLKRRRPKNYPPGPLALPFVGNFFHLD
FERSHLTIQRFVKKYGNIMSMQLGDLPLVLVTGLPLIKEILVDQNQIFVNRPITPIRERI
FKNNGLIMSSGQTWKEQRRFTLATLRNFGLGRKSLEERIQEEAHHLIQAIEEENGQPFNP
HFKMNNAVSNIICSLTFGKRFEYEDEQFQELLRLLDEVMYLETSMRCQLYNVFPRIMKFL
PGPHQTLFSHWEKLKSFIAHMTENHRKDWNPAEPRDFIDAYLKEIEKNRDNAASSFHGEN
LICSTLDLFFAGTETTSTTLRWGLLYLALNPEIQEKVQAEIDRVIGRSQLPSIAARESLP
YTNAVIHEVQRMGNIIPLNVPREVTGDTTLAGYYLPKGTMILTNLTALHRDPAEWATPDT
FNPEHFLENGQFKKRETFLPFSVGKRVCLGEQLAKSELFIFFTSLVQKFTFRPPNNEQLS
LKFRTGLTISPVNHRLCAVPRA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcggcgatgggctccctggcggccgccgtctgggcgatgggccacctccgcacc
ctgctgctgggtgccgtcgcctttctgttctttgccgattgcctcaaaagacggcgccca
aagaactacccgccaggtcccctagccctgcccttcgtgggcaacttcttccatctggac
tttgagcggtcgcacctgacgattcagcggtttgtgaagaaatacggaaacatcatgagc
atgcagctcggtgacttgcctttagttcttgtaactggattgcccttgatcaaagaaatc
cttgtcgaccagaaccaaatctttgtgaaccgccctataactcctatccgagaacgtatc
tttaagaacaatggattgatcatgtccagtggccaaacatggaaggagcaaagaaggttc
acgctggcaacactaaggaactttggcctaggaaggaagagcttagaggaacgcattcag
gaggaggcccatcacctcatccaggcaatagaagaagagaatggacagcctttcaaccct
cacttcaagatgaacaatgcagtttccaatattatttgttctctcacctttgggaaacgc
tttgagtacgaggatgaacagtttcaggaattgctgaggctgctggatgaggtcatgtat
ctggagacatcaatgagatgccagctctacaatgtctttccacgaattatgaaatttctt
cctggacctcatcaaacactctttagccactgggagaagctgaaatcgttcattgctcat
atgactgaaaaccacaggaaagactggaatcctgctgaaccaagagattttattgacgct
tacctcaaggaaatagaaaagaatagggacaatgctgcttcaagtttccatggagaaaac
ctcatctgtagcaccctggacctcttctttgctggaactgagacaacttcaacaacactg
cgctggggtctgctttacttggccctcaacccagaaatccaagaaaaagtccaagctgag
atcgacagggtgattggccggtcacagctgccaagtatagctgctcgggagtccctgccc
tacaccaacgccgtcatccatgaggtgcagagaatgggaaacatcatccccctgaacgtg
cccagggaggtgacaggtgataccacgcttgctggatactacctgcccaagggtaccatg
atcctgaccaatctgactgcactgcacagggaccctgcagaatgggccacccccgacacg
ttcaatccggagcattttctggagaatggacagtttaagaaaagggaaacctttctgcct
ttctcagtaggaaagagggtatgccttggagagcagttggccaagtctgagctgtttatc
ttcttcacttccctcgtgcaaaaatttaccttcaggcccccaaacaatgagcagctgagc
ctgaagttcagaacgggcctcaccatctccccagtcaaccatcgactctgcgcagtccct
cgggcatga

DBGET integrated database retrieval system