KEGG   Ailuropoda melanoleuca (giant panda): 100482335Help
Entry
100482335         CDS       T01329                                 

Definition
cytochrome P450 2J2-like
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:aml00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:aml00591]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:aml04913]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:aml04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:aml04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 502 aa AA seqDB search
MLAAMGSLAAAVWAMGHLRTLLLGAVAFLFFADCLKRRRPKNYPPGPLALPFVGNFFHLD
FERSHLTIQRFVKKYGNIMSMQLGDLPLVLVTGLPLIKEILVDQNQIFVNRPITPIRERI
FKNNGLIMSSGQTWKEQRRFTLATLRNFGLGRKSLEERIQEEAHHLIQAIEEENGQPFNP
HFKMNNAVSNIICSLTFGKRFEYEDEQFQELLRLLDEVMYLETSMRCQLYNVFPRIMKFL
PGPHQTLFSHWEKLKSFIAHMTENHRKDWNPAEPRDFIDAYLKEIEKNRDNAASSFHGEN
LICSTLDLFFAGTETTSTTLRWGLLYLALNPEIQEKVQAEIDRVIGRSQLPSIAARESLP
YTNAVIHEVQRMGNIIPLNVPREVTGDTTLAGYYLPKGTMILTNLTALHRDPAEWATPDT
FNPEHFLENGQFKKRETFLPFSVGKRVCLGEQLAKSELFIFFTSLVQKFTFRPPNNEQLS
LKFRTGLTISPVNHRLCAVPRA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcggcgatgggctccctggcggccgccgtctgggcgatgggccacctccgcacc
ctgctgctgggtgccgtcgcctttctgttctttgccgattgcctcaaaagacggcgccca
aagaactacccgccaggtcccctagccctgcccttcgtgggcaacttcttccatctggac
tttgagcggtcgcacctgacgattcagcggtttgtgaagaaatacggaaacatcatgagc
atgcagctcggtgacttgcctttagttcttgtaactggattgcccttgatcaaagaaatc
cttgtcgaccagaaccaaatctttgtgaaccgccctataactcctatccgagaacgtatc
tttaagaacaatggattgatcatgtccagtggccaaacatggaaggagcaaagaaggttc
acgctggcaacactaaggaactttggcctaggaaggaagagcttagaggaacgcattcag
gaggaggcccatcacctcatccaggcaatagaagaagagaatggacagcctttcaaccct
cacttcaagatgaacaatgcagtttccaatattatttgttctctcacctttgggaaacgc
tttgagtacgaggatgaacagtttcaggaattgctgaggctgctggatgaggtcatgtat
ctggagacatcaatgagatgccagctctacaatgtctttccacgaattatgaaatttctt
cctggacctcatcaaacactctttagccactgggagaagctgaaatcgttcattgctcat
atgactgaaaaccacaggaaagactggaatcctgctgaaccaagagattttattgacgct
tacctcaaggaaatagaaaagaatagggacaatgctgcttcaagtttccatggagaaaac
ctcatctgtagcaccctggacctcttctttgctggaactgagacaacttcaacaacactg
cgctggggtctgctttacttggccctcaacccagaaatccaagaaaaagtccaagctgag
atcgacagggtgattggccggtcacagctgccaagtatagctgctcgggagtccctgccc
tacaccaacgccgtcatccatgaggtgcagagaatgggaaacatcatccccctgaacgtg
cccagggaggtgacaggtgataccacgcttgctggatactacctgcccaagggtaccatg
atcctgaccaatctgactgcactgcacagggaccctgcagaatgggccacccccgacacg
ttcaatccggagcattttctggagaatggacagtttaagaaaagggaaacctttctgcct
ttctcagtaggaaagagggtatgccttggagagcagttggccaagtctgagctgtttatc
ttcttcacttccctcgtgcaaaaatttaccttcaggcccccaaacaatgagcagctgagc
ctgaagttcagaacgggcctcaccatctccccagtcaaccatcgactctgcgcagtccct
cgggcatga

DBGET integrated database retrieval system