KEGG   Ailuropoda melanoleuca (giant panda): 100482382Help
Entry
100482382         CDS       T01329                                 

Gene name
NCOA3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100482382 (NCOA3)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100482382 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1408 aa AA seqDB search
MSGLGENSLDPLAPDSRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAISNDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVN
GVAWTNETQRQKSHTFNCRMLMKTPHDILEDLNTGPEMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERAFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRPNTNPVGPGIRPPAAGCNSSVGGMNMSPNQGLQMLSNRTYGL
ADPSTTGQMSGARYGASNPIASMNPGPGMQSPSSYQSSNYGLNMSSPPHGSPGLGSNQQN
IMISPRNRGSPKMASHQFSPVAGVHSPMGSSSNTGSHSFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDNSPSMNMSQPNKVNSQDSKSPLGLYCDQNPVESSMCQSNSRDHLGDKESK
ESSIEGSENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTSSPLDSSCKDSSISVTSPSGV
SSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTAACVEG
NVKQEQLSPKKKENNALLRYLLDREDPSDTLSKELQPKVEGVDGKMSQCSSSTIPSSSQE
KDSKIKTETNEEGSGDLDNLDAILGDLTSSDFYNNSISTNGSNLGTKQQMFQGTNSLGLR
SPQSVQAIRPPYNRAVSLDSPLSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGS
TMGGPNRNVTVNQAPSSGDWGLPNSKASRMEPMSANSMGRPGADYNASLPRPAVGSSMPT
LPLRASSIPGARPVLQQQQQMLQMRPGEIPMGMGVSPYGQAAPSNQPGSWPDGMLSMEQG
PHGAPNRPLLRNSLDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIPE
LVNQGQALESKQDAFQGQEAALMLDQKATLYGQTYPAQGPPMQGGFNLQGQSPSFNSVMT
QMNQQGGFPLQGMHPRASVLRPRTSSPKQLRLQLQQRLQGQQFLNQSRQALEMKMDSPTA
GSAAVMRPMMQPQVTSQGFLNAQMVAQRSRELLSHHFRQQRVAMMTQQQQQQQQQPPPPP
PQPQAFSPPPNVTASPSMDGVLAGPVMPQAPPQQFPYPPNYGMGQQPDPAFGRVSSPPNA
MMPSRMGPSQNPMMQHPQTAPMYQSSEIKGWPSGNLARNSSFPQQQFAHQGNPAAYSMVH
MNGSSGPMGQMNMTSMPVAGMPTGPDQN
NT seq 4227 nt NT seq  +upstreamnt  +downstreamnt
atgagcggattaggagaaaactccttggatcctctggcccccgattcacgaaaacgcaaa
ttgccatgtgatactccaggacaaggtcttacctgcagtggtgaaaagtggagacgggag
caggagagtaaatatattgaagaattggctgaactgatatctgctaatcttagtgatatt
gacaatttcaatgtcaaaccagataaatgtgcaattttaaaggaaacagtaagacagata
cgtcaaataaaagagcaaggaaaagctatttccaatgatgatgatgttcagaaagctgat
gtatcctctacaggacagggggttattgataaagactccttagggccacttttacttcag
gcattggatggtttcctgtttgtggtgaatcgtgatggaaacattgtatttgtgtcagaa
aatgtcacacagtatctgcagtataagcaagaagacctggttaacacaagtgtctacaat
atcttgcatgaagaagacagaaaggattttcttaaaaacttaccgaaatctacagttaat
ggggttgcctggacaaatgagacccagagacaaaaaagccatacatttaattgccgtatg
ttgatgaaaacacctcatgatattctggaagacttaaacactggtcctgaaatgcgccag
agatacgaaacaatgcaatgctttgccctgtctcagccacgagccatgatggaggaaggg
gaagatttgcagtcctgtatgatctgtgtagcacgccgcattactacaggagaaagagca
tttccctcaaaccctgagagctttattactagacatgatctttcaggaaaagttgtcaac
atagatacaaattcactgagatcctccatgagacctggctttgaggatataatccgaagg
tgtatccagagattttttagtcttaatgatggtcagtcatggtcccagaaacgtcactat
caagaagcttatatccatggccatgcagaaaccccggtgtatcgattctcattggctgat
ggaaccatagtgacagcacaaaccaaaagcaaactcttccgaaatcctgtcacaaatgat
cggcatggctttgtctcaacccactttcttcagagggaacagaatgggtatagaccaaat
acgaatcccgttggaccaggcattagacctccagcagccggatgcaatagttccgtaggt
ggcatgaatatgtcgccaaaccagggtttacagatgctgagcaacaggacctatggcttg
gccgaccccagcaccacagggcagatgagcggagctagatacggggcctccaatcccata
gcatcaatgaaccctgggccaggcatgcagtcaccatcttcctaccagagcagcaactac
ggtctcaacatgagtagccccccacatgggagccctggccttggctccaaccagcagaac
atcatgatttctcctcgtaaccgtgggagtccaaagatggcctcacatcagttttctcct
gttgcaggtgtacactctcccatgggatcttctagtaatactgggagccacagcttttcc
agcagctctctgagtgctcttcaagctatcagtgagggcgtggggacttctcttttatcc
actctgtcttcaccaggccccaaattggataactctcccagtatgaatatgagccagcca
aataaagtgaacagtcaggattccaagagtcctctgggcttgtattgtgaccagaatcca
gtggagagttcgatgtgtcagtcaaatagcagggatcacctcggtgacaaagaaagtaag
gagagcagtattgaagggtcagagaatcagagaggtcctctggaaagcaaaggtcataag
aaattactgcagttacttacctgttcttctgatgaccggggccattcctccttgaccagc
tcccccctggattcaagttgtaaagactcttccattagtgtcaccagcccctctggggtc
tcttcttccacctctggaggagtgtcctccacgtcgaatatgcatggctcactgctgcag
gagaagcaccggattctgcacaagttgctgcagaatgggaattcacccgcagaagtagcc
aagatcaccgcagaagccactgggaaagacaccagtagtacggcagcctgcgtggaagga
aatgtcaagcaggaacaactgagtcccaagaagaaggagaataatgcacttcttcgatat
ctgctggacagggaggatcctagcgatacactctctaaagaactgcagcccaaagtggag
ggagtggacggtaaaatgagtcagtgcagcagctccaccattcctagctcgagtcaagag
aaggactctaaaattaagacagaaacaaatgaagagggatctggagacttggataatcta
gatgctattcttggtgatctgactagttctgacttttacaataattccatatccacaaat
ggtagtaatctgggaaccaagcaacaaatgtttcaaggaactaattctctgggtttgagg
agtccacagtctgtgcaggccattcgtcccccatataaccgagcggtatctctagatagc
cctctttcggttggctcaagtcctccagtaaagaacatcagtgctttccccatgttacca
aagcagcccatgttgggtgggaatccaagaatgatggatagtcaggaaaattatggctca
actatgggtggaccaaacagaaatgtgactgtgaatcaggctccttcctcaggagattgg
ggcttaccaaactcaaaggccagtagaatggagcctatgagtgcaaactccatgggaaga
ccaggagcagattataacgcttccttacccagacctgcggtgggcagctcgatgcccacc
ttgcctctgcgggccagcagcatcccaggggcgagacctgtgttacagcagcagcagcag
atgcttcaaatgcggcctggtgagattcccatgggaatgggggtcagtccgtatggccag
gcagcaccgtctaaccaaccgggttcctggccagatggcatgttgtccatggaacagggc
cctcatggggctccaaataggccacttcttaggaattccctggatgatctccttgggcca
ccttctaacctagaagggcagagtgatgaaagagcgttgttggaccagctgcatactctc
ttgagcaacacagatgccacaggcttggaagaaatcgacagagctctcggcatccctgaa
cttgtaaatcaaggacaagctttggagtccaaacaggatgctttccagggccaagaagcg
gcactaatgctggatcagaaggcgacattatatgggcagacgtacccggcgcaggggcct
cccatgcaaggaggctttaatcttcagggacagtcaccatcttttaactctgtgatgact
cagatgaaccagcaaggcggttttcctctccaaggaatgcacccaagggccagcgtcctg
cgaccccggacgagcagccccaagcagctccggctgcagcttcagcagaggctgcagggc
cagcagtttttgaatcagagccgtcaggcactggagatgaaaatggacagccccactgct
gggagtgctgctgtgatgaggcccatgatgcagccccaggtcacctcccagggctttctg
aacgcccagatggtggcgcagcgcagcagggagctgctcagtcatcacttccggcagcag
cgggtggccatgatgacgcagcagcagcagcagcagcagcagcagccgccaccgcctccg
ccgcagccccaggccttcagcccgcccccgaacgtgacggcctcccccagcatggatggc
gttttggcagggccggtgatgccacaggctcctccccagcagtttccatatccaccaaat
tatggaatgggacagcaaccagatccggcctttggtcgagtgtctagtcctcccaatgca
atgatgccctcaagaatgggtccctcgcagaatcccatgatgcagcaccctcagaccgca
cccatgtatcagtcctcggaaataaagggctggccgtcaggaaacctagccaggaacagc
tccttcccccagcagcaattcgcccaccaggggaaccccgcagcctacagtatggtgcac
atgaatggcagcagcggccccatgggacagatgaacatgacctccatgcccgtggctggc
atgcccacgggtcccgatcagaactaa

DBGET integrated database retrieval system