KEGG   Ailuropoda melanoleuca (giant panda): 100482445Help
Entry
100482445         CDS       T01329                                 

Gene name
USP32
Definition
(RefSeq) ubiquitin specific peptidase 32
  KO
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.4.19.12]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100482445 (USP32)
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100482445 (USP32)
Ubiquitin system [BR:aml04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100482445 (USP32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 1680 aa AA seqDB search
MGTVQGQTSRQLLRSRPLDARTGGREPRSRAPRKSPSQVGGGSRALRLRIGGKLRDDALR
AGSGSSPTLLRAESVGRGGVCGPWWPLPGTIPGLGRWRRPGGGAKESRIGFLSYEEALRR
VTDVELKRLKDAFKRTCGLSYYMGQHCFIREVLGDGVPPKVAEVIYCSFGGTSKGLHFNN
LIVGLVLLTRGRDEEKAKYIFSLFASESGSYVVREEMERMLHVVDGKVPDTLRKCFSEGE
KVNYEKFRNWLLLNKDAFTFSRWLLSGGVYVTLTDDSDTPTFYQTLAGVTHCKAPIDIPG
GHRNKSVVYGLFNAFDENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLS
RVELRDMVVALSEVWKDNRTDDIPELHTDLSGIVEGILNAHDTTKMGHLTLEDYQIWSVK
NVLANEFLNLLFQVCHIVLGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFIISMQWWQ
QWKEYVKYDASPVVIEPSSVLNGGKYSFGTAGHCIEQSEDRIGGGSLSSVNTTEEKFSDN
ISSASEASETAGSGFLYSATPGADMCFARQHNTSDNNNQCLLGANGNILLHLNPQKPGAI
DNQPLVTQEPVKATSLTLEGGRLKRTPQLIHGRDYEMVPEPVWRALYHWYGANLALPRPV
IKNSKTEIPELELFPRYLLFLRQQPATRTQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSR
MQTIKEIHEYLSQRLRIKEEDMRLWLYNSENYLTLLDDEDHRLEYLKIQDEQHLVIEVRN
KDMSWPEEMSFIANSSKIDRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFIS
GRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKNVAPLKLPWTIAKYAPRFNGFQQQ
DSQELLAFLLDGLHEDLNRVHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIVVDLFH
GQLRSQVRCKTCGHISVRFDPFNFLSLPLPMDSYMHLEITVIKLDGTTPVRYGLRLNMDE
KYTGLKKQLSDLCGLKSEQILLAEVHGSNIKNFPQDNQKVRLSVSGFLCAFEIPIPGSPI
SASSPIQTDFSSSPSTNGMFTLTTNGDLPRPIFIPNGMPNTVVPCGTEKNFTNGVVNGHM
PSLPDNSFTGYIIAVHRKMMRTELYFLSSQKNRPSLFGMPLIVPCTVHTRKKDLYDAVWI
QVSRLASPLPPQEASNHAQDCDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCKIDCG
EDRAFIGNAYIAVDWDPTALHLRYQTSQERVVDEHESVEQSRRAQAEPINLDSCLRAFTS
EEELGENEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQKIVKFPRE
SFDPSAFLVPRDPALCQRKPLTPQGDDLSEPRVPGGDVKKVDAQNSAGEEDVLLSKSPSS
LSANIISSPKGSPSSTRKSRTSCPSSKNSSPNSSPRTLGRSKGRLRLPQIGSKNKLSSIK
ENLDASKENGAGQVCELADALSRGHMLGGSQTELVTPQDHEVALANGFLYEHEACGNGYS
NGQLENHSEEDSTDDQREDVHVKPIYNLYAISCHSGILGGGHYVTYAKNPNSKWYCYNDS
SCKELHPDEIDTDSAYILFYEQQGIDYAQFLPKIDGKKMADTSSMDEDFESDYKKYCVLQ
NT seq 5043 nt NT seq  +upstreamnt  +downstreamnt
atggggactgtccaaggacagaccagccgccagttgctccggtcccgccctttagacgcc
agaacgggtgggcgagagccacggagccgagcgccccggaagtcgccctctcaggtgggc
ggagggtcccgggccttgcggcttcggattggcgggaagctgcgggatgacgcgctacgc
gcgggatccggctcctcccctacgctcctgcgcgcggagagcgtggggcggggcggagtg
tgtggcccctggtggccattacccggaacaatccccggcctcgggcggtggcggcggccg
ggaggaggcgccaaggagtcacggatcggattcctcagctacgaggaggcgctgaggaga
gttacagatgtagagctgaaacgactgaaagatgcctttaaaaggacctgtggactctca
tactatatgggccagcactgcttcatcagggaagtgcttggggatggagtgcctccaaaa
gttgctgaggtgatttactgttcctttggtggaacatccaaaggactgcacttcaataac
ttaatagttggacttgtgcttcttacaagaggcagagatgaagagaaagcaaaatacatt
tttagtctttttgcaagtgaatctgggagctatgttgtacgggaagaaatggaaagaatg
ctccatgtggtggatggtaaagtcccagatacactcaggaagtgtttctcagagggtgaa
aaggtaaactatgaaaagtttagaaattggcttcttctaaacaaagatgcttttaccttc
tctcgttggctactatctggaggtgtttatgtgaccctcactgatgatagtgatactccc
actttctaccaaactctcgctggagtcacacattgtaaggcccccattgatatccctggt
ggccatagaaataagtcagtagtgtatggtttgtttaatgcttttgatgaaaatcgtgac
aatcacatagattttaaggagatatcttgtgggttatcagcctgttgcaggggacccctg
gctgaaagacaaaaattttgcttcaaggtgtttgatgttgaccgtgatggagttctctct
agggttgaactgagggacatggtggttgcactttcagaggtgtggaaggacaaccgcaca
gatgatatcccggagttacatacagatctatctggcattgtagaaggcatattgaatgca
catgacaccacaaagatgggccatcttactctagaagactatcagatctggagtgtgaaa
aatgttcttgccaatgaatttttgaatctacttttccaggtatgtcacatagttctgggg
ttaagaccagctactccagaagaggaaggacaaattattagaggatggttagaacgagag
agcaggtatggtctgcaaccaggacacaattggtttatcatctccatgcagtggtggcag
cagtggaaagaatatgtcaaatatgatgccagccctgttgtaattgagccatcatctgtt
ctgaatggaggaaaatactcatttggaacagcaggacattgtatagagcagagtgaagat
agaatcggaggaggcagcctcagttctgtgaacaccacagaagagaaattttcagacaac
atttcttctgcatctgaagcctcagaaactgctggcagtggctttctgtattctgccaca
ccaggggcagatatgtgctttgctcgacaacataacacttctgacaataacaaccagtgt
ttgctaggagccaatgggaatattttgttgcatctcaatcctcagaaaccaggggctatt
gataaccagccactagtaactcaagaacctgtaaaggctacatcactaacactagaagga
ggacgattaaaacgaaccccacagctgatccacggaagagattatgaaatggtcccagaa
cctgtgtggagagcactttatcactggtatggagcaaacctggctctacctagacctgtg
atcaagaatagcaaaacagaaatcccagagctggagttatttcctcgctatcttctcttc
ctaagacagcagcctgccactcggacacagcagtctaacatctgggtgaatatgggaaat
gtaccttctccgaatgcgccactaaagcgggtcttagcctatacaggctgttttagtcga
atgcagaccatcaaggaaattcatgaatatctgtctcaaaggctacgcatcaaagaggaa
gatatgcgcctctggctctacaacagtgagaattaccttactcttctggatgatgaggat
catagattggaatatttgaaaatccaagatgagcagcatctggtaattgaagttcgcaat
aaagatatgagttggcctgaggaaatgtcctttatagcaaacagtagtaaaatagataga
cacaaggttcctacagaaaaaggagccactggtctgagtaacctgggaaacacttgtttc
atgaactcaagcatccagtgtgttagtaacacacagccactgacacaatattttatctca
gggagacatctttatgaacttaacaggacaaatcccattggtatgaaggggcatatggct
aaatgctatggggatttagtgcaggaactttggagcggaactcagaagaatgttgcccca
ttaaagcttccgtggaccatagcaaaatatgctcccaggtttaatgggtttcagcaacaa
gactcccaagaacttctggcttttctcttggatggtcttcatgaagatctcaaccgagtc
catgagaagccatatgtggaattgaaggacagcgatggccgaccagactgggaagtagct
gcagaggcctgggacaaccatctgagaaggaatagatcaattgttgtagatttgttccat
gggcagctgaggtcccaagtcagatgcaagacatgtgggcatataagtgtccgatttgac
cctttcaattttttgtctttgccactaccaatggacagttacatgcacttagaaataaca
gttattaagctggatggtactacccctgtacgatacggactacgactgaatatggatgaa
aagtatacaggattaaaaaaacagctgagcgatctctgtgggcttaaatcagaacaaatc
cttcttgcggaagtacatggttccaatataaagaatttccctcaagacaaccaaaaagta
cgactctcagtgagtggatttttgtgtgcatttgaaatccccattcctggatctccaatt
tcagcttctagtccaatacagacagatttctcctcttccccatctacaaacggaatgttc
actctaaccaccaatggggacttgccccgaccaatattcatacccaatggaatgccaaac
actgttgtgccatgtggaactgagaagaacttcacaaatggagtggtgaatggtcatatg
ccatctcttcctgacaattcctttacaggctacatcatcgcagtccaccgaaaaatgatg
aggacagaactgtatttcctttcatctcagaagaatcgccccagcctctttggaatgcca
ctgattgtcccatgtactgtgcatacccggaagaaggacttgtatgatgcagtttggatt
caggtgtctcgattagccagcccactcccacctcaggaagccagtaaccatgctcaggat
tgtgatgacagtatgggctatcaatatcccttcactctacgagttgtgcagaaagatggg
aactcctgtgcctggtgcccatggtatagattttgcagaggctgtaaaattgattgtggg
gaagacagagctttcatcggaaatgcctatattgctgtggattgggaccccacagctctt
cacctccgctatcagacatcacaggagagggttgtcgatgagcatgagagtgtggaacag
agtcggcgagcacaagctgagcccatcaacctggacagctgtctccgtgctttcaccagt
gaggaggagctaggggaaaatgagatgtactactgttccaagtgtaagacccactgcttg
gcaaccaagaagctggatctctggaggcttccccccatcctgatcattcaccttaaacga
tttcagtttgtaaatggtcgatggataaaatctcagaaaattgttaaatttcctcgtgaa
agttttgaccctagtgcttttttggtaccaagagacccggctctctgtcagcgtaaacca
ctcacaccccagggggatgacctctctgagcccagggttccgggaggagacgtgaagaaa
gtggatgctcagaattcagctggggaagaggatgtgctcctgagcaagagcccgtcttca
ctcagtgcaaacatcatcagtagccctaaaggttcaccttcttcaacaagaaaaagcaga
accagctgtccctccagcaaaaatagcagccctaacagtagccctaggactttagggagg
agcaaagggaggctccggctaccccagattggcagcaaaaataaactgtcaagtattaag
gagaacttggatgccagcaaagagaatggggctggacaagtctgtgagctggctgatgcc
ttgagccgagggcacatgctggggggcagccaaactgagctggtcacccctcaggaccac
gaagtagctctggccaatggatttctgtatgagcacgaggcatgtggcaatggctacagc
aatggtcagcttgaaaaccacagtgaagaagacagtaccgatgaccaaagagaagatgtt
catgttaagcctatttataatctatatgcaatttcgtgccattcaggaattctgggcggg
ggccattatgtcacttatgccaaaaacccaaacagcaagtggtactgttataatgacagc
agctgtaaggaacttcaccctgatgaaattgacaccgactctgcctacattcttttctat
gagcagcaggggatagactatgcacaattcctgccaaagatcgatggcaaaaagatggca
gacacgagcagcatggatgaagactttgagtccgattacaaaaagtactgtgtgttacag
taa

DBGET integrated database retrieval system