KEGG   Ailuropoda melanoleuca (giant panda): 100482446Help
Entry
100482446         CDS       T01329                                 

Gene name
PFN2
Definition
(RefSeq) profilin 2
  KO
K05759  
profilin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100482446 (PFN2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100482446 (PFN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100482446 (PFN2)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100482446 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 91 aa AA seqDB search
MIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRV
LVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaggaaaagaccgggaaggtttctttaccaacggtttgactcttggcgcaaag
aagtgctcggtgatcagagatagcctatacgtcgatggtgactgcacaatggacatccgg
acaaagagtcaaggtggggagccaacatacaacgttgctgtcggcagagctggtagagtc
ttggtctttgtaatgggaaaagaaggggtccatggaggcggattgaataagaaggcatac
tcaatggcaaaatacttgagagactctgggttctag

DBGET integrated database retrieval system