KEGG   Ailuropoda melanoleuca (giant panda): 100482446Help
Entry
100482446         CDS       T01329                                 

Definition
uncharacterized LOC100482446
Orthology
K05759  
profilin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100482446
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100482446
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100482446
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100482446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 241 aa AA seqDB search
MFLRATNASSDFRLSGRALSAAKTAKGRGAPGKRVPLKTPEMSVGDSPPATPTTNRSKRS
TSRHQDNSAIQHQGSRFRIPSHRTQKRGASPPGREDWRRPRRPRPWGAECNGGASLSSDL
GQPPPATPPHSDLSAARGGRDCPRAPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLY
VDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSG
F
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgagagccacaaatgccagctcagatttcaggttgtcgggacgcgccctctcg
gctgccaagaccgccaaagggcggggggctccagggaagagggtcccattgaagacgccc
gagatgagcgtgggcgactccccccctgccactcccaccacaaacaggagtaaacgctcc
acatcccgtcaccaggacaactcggcaatccaacaccaaggctcaagattccgcatcccc
agccaccggacgcagaagagaggcgcatcaccaccgggccgcgaagactggaggcgtccc
agacgcccccgtccctggggagccgaatgcaacggaggagcatccctctcctcggacctc
gggcagccgcccccagcgaccccaccgcactcggacctctctgccgcacgtggcggtcgt
gattgtcccagagcgccagtggaaatagatatgattgtaggaaaagaccgggaaggtttc
tttaccaacggtttgactcttggcgcaaagaagtgctcggtgatcagagatagcctatac
gtcgatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatac
aacgttgctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtc
catggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctggg
ttctag

DBGET integrated database retrieval system