KEGG   Ailuropoda melanoleuca (giant panda): 100482572Help
Entry
100482572         CDS       T01329                                 

Definition
lymphokine-activated killer T-cell-originated protein kinase-like
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100482572
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   100482572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 323 aa AA seqDB search
MEEINNFKTPSKLSEKKKSALCSTPCINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSP
WAVKKINPRCNDHYQSMYQKRLIDEAKILKNLHHPNIVGYRAFTEASDGSLCLAMEYGGE
KSLNDLIEERNKDSQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFE
TIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEALEENGIITDKADIFAFGLTLWEM
MTLSIPHINLPDDDDDEDKTFDESDFDDEAYYAALGTRPPVNMEELDETYQKVIELFSVC
TNEDPKDRPSAAHIVEALEIDVQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaatcaataatttcaagacaccaagcaaattatctgaaaaaaagaaatctgca
ttatgttcaactccatgtataaatattcctgcctctccgtttatgcagaagcttggcttt
ggcactggggtaaatgtctacctcatgaaaagatctccaagaggtttgtctcattctcct
tgggctgtgaaaaagattaaccctagatgtaatgatcattatcaaagtatgtatcaaaag
agactaatagatgaagctaagattttgaaaaacctccatcatccaaacattgtaggttat
cgtgctttcactgaagccagtgatggtagtctttgtcttgctatggaatatggaggtgaa
aagtctctaaatgacttaatagaagaacgaaataaagatagccaggatcctttcccagca
gccataattttaaaagttgctttgaacatggcaagagggttaaagtatctccaccaagaa
aagaaactgcttcatggagacataaagtcttcaaatgtagtaattaaaggtgattttgaa
acaattaaaatctgtgatgtaggagtctctctaccactggatgaaaatatgactgtgact
gaccccgaggcctgttacattggcaccgagccttggaaacccaaggaagctttggaagag
aatggtattattactgacaaggcagacatatttgcctttggcctgactctgtgggaaatg
atgactttgtctattccacatattaatcttccagatgatgatgatgatgaagataaaact
tttgatgaaagtgactttgacgatgaagcgtactatgcagctctggggacaaggccacct
gttaatatggaagaactggatgaaacataccagaaagtaattgaactcttctctgtatgc
actaacgaagacccgaaagatcgtccttctgccgcacacattgtagaagctttggaaata
gatgtccagtga

DBGET integrated database retrieval system