KEGG   Ailuropoda melanoleuca (giant panda): 100482589Help
Entry
100482589         CDS       T01329                                 

Gene name
CES2
Definition
(RefSeq) carboxylesterase 2
  KO
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100482589 (CES2)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100482589 (CES2)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     100482589 (CES2)
    3.1.1.84  cocaine esterase
     100482589 (CES2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 559 aa AA seqDB search
MLLDRLRRWLNAVVCGLLPFLVLGLGQESASPIRTTHTGQVRGSLIHVKDTDVGVHTFLG
IPFAKPPLGPLRFAPPEPPEPWSGVKDGTSHPAICLQDLTFMKILALKLLNMTLPFTSMS
EDCLYLSVYTPVHASEGSNLPVLVWIHGGALVTGMASMYDGSLLAAFEDVVVVTIQYRLG
ILGFFSTGDKHAPGNWGYLDQVAALRWVQQNIAYFGGDPGLVTIFGESAGGTSVSSHVVS
PMSQGLFHRAIMESGVALLPGLIASSSDAISAMAANLSACGQVDSEVLVGCLRDKTEEEI
LAINKLFKIIPGVVDGTFLPRHPQELLASANFQPVPSIIGVNSDEYGWIIPLVMNISEAQ
KEMDRETVKAILQQVLGMLTLPPESFDLLMEEYMGDSGDPQTLRAQFHEMMGDSVFVIPA
LQVANFQRSHSPVYFYEFQHRPSFLKDIRPPHVKADHGDELLFVFGTLPWGANVEVTEEE
KLLSRKIMKYWANFARNGNPNGEGLPHWPVFDQEEQYLQLNTQPAVGRALKAHRLQFWTK
TLPQKTQELMEAGDKHTEL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaccgacttcgccggtggctgaacgccgtggtctgtgggctcctacctttc
ctcgtcctgggcctgggccaggaatctgccagccccatccggaccacacacacggggcaa
gtgcgggggagcctcatccatgtgaaagacactgatgtgggagtccacaccttcctggga
attccctttgccaagccgcctctagggcccctgcgatttgcaccccctgagcctcctgaa
ccttggagtggtgtaaaggatgggacctcccacccagccatctgtctgcaggacctcact
ttcatgaaaatactggctctgaaactgctgaatatgaccctgcctttcacctccatgtct
gaagactgcctgtaccttagtgtctatacacctgtccacgccagtgaaggttccaattta
cctgtgttggtgtggatccacggtggtgcgcttgtgacgggcatggcttccatgtatgat
ggctctttgctggcggcctttgaggatgtagtggtggtcactatccagtaccgcctgggt
atactgggcttcttcagcactggagacaagcacgcacccggcaattggggctacctggat
caagtggctgcactacgctgggtccagcaaaatattgcctattttggaggcgaccctggc
cttgtcaccatttttggcgagtccgcgggtggcacaagtgtgtcctcccatgtcgtgtcc
cccatgtcacaaggactcttccatcgtgccatcatggagagtggtgtggcccttttgccc
ggccttattgccagctcatctgatgcgatctccgcaatggcggccaatctgtctgcctgt
ggccaggttgactcagaggtcctggtgggctgcctgcgggacaaaactgaagaggagatt
ttagccatcaacaagctcttcaagatcatccctggcgtagtggatgggaccttcctgccc
aggcacccccaggagctgctggcctccgccaactttcaacctgtccccagcatcattggt
gttaacagtgatgagtacggctggatcatccccttggtcatgaacatctctgaggcccag
aaggaaatggacagagagacggtgaaggccattctgcagcaagtgttgggaatgttgacg
ttgcctcctgagtcttttgacctgttgatggaggagtacatgggggacagtggggaccca
cagaccctgcgagcccagttccatgagatgatgggggactctgtcttcgtgatccctgca
ctccaagtagccaattttcagcgctcacactccccagtctacttctatgagttccagcat
cggcccagcttcttaaaggacatcaggccaccccatgtgaaggcagaccatggcgatgag
ttactctttgtcttcggaaccctcccttggggagccaacgttgaagtcacggaggaagaa
aagctgttgagcaggaaaataatgaagtattgggctaactttgctcgaaatgggaacccc
aatggcgagggtctcccccactggcccgtgtttgaccaggaagagcagtatctgcagctg
aacacgcagcctgcagtgggccgggctctgaaggcgcacaggcttcagttctggacaaag
accctgccccagaagacacaggagctgatggaggcaggggacaagcacacagagctgtag

DBGET integrated database retrieval system