KEGG   Ailuropoda melanoleuca (giant panda): 100482672Help
Entry
100482672         CDS       T01329                                 

Gene name
PAICS
Definition
(RefSeq) phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
  KO
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100482672 (PAICS)
Enzymes [BR:aml01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     100482672 (PAICS)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     100482672 (PAICS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 425 aa AA seqDB search
MATAEVLNIGKKLYEGKTKEVYELPDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKT
TSCIFQLLKEAGIKTAFTRKCGETAFIAPKCAMIPIEWVCRRIATGSFLKRNPGVKEGYK
FYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLVIGQTEVDIMSHATQAIFEILEKSW
LPQNCTLVDMKIEFGVDITTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPE
GLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSSSDLSHCEKIKKACGNFGIPCELRIT
SAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVINCPPLTPDWGAQ
DVWSSLRLPSGLGCSTILSPEGSAQFATQIFGLNNHLVWAKLRASILNTWISLKQADKKI
REGNL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagctgaggtactgaatattggtaaaaaactctatgagggtaaaacaaaagaa
gtctatgaattgccagatagtcccggaaaagtcctcctgcagtccaaggaccagataaca
gcaggaaatgcagccagaaagaatcacctggaaggaaaagctgcaatctcaaataaaact
accagttgtatttttcagttgttaaaggaagcaggtatcaaaactgctttcaccagaaaa
tgtggggagacagctttcattgcacctaagtgtgcaatgattccaattgaatgggtttgt
agaagaatagcaactggttctttcctcaaaagaaatcctggtgtcaaggagggatataaa
ttttacccacctaaagtggagctgtttttcaaggatgatgccaataatgatccacagtgg
tctgaagaacagctaattgcagcaaaattttgctttgctggacttgttataggccagact
gaagtggatatcatgagtcatgctacacaggctatttttgaaatactggagaaatcctgg
ttgccccagaactgtacactggttgatatgaagattgaatttggtgttgatataactacc
aaagaaattgttcttgctgatgttattgataatgattcctggagactctggccatcagga
gaccgaagccaacagaaagataaacagtcatatcgtgacctcaaggaagtaacccccgaa
gggctccagatggtgaagaagaattttgagtgggttgcagaaagagtggagttgcttctg
aaatcagaaagtcagtgcagagttgtagtattgatgggctcatcttccgatctcagtcac
tgtgaaaaaatcaagaaggcttgtggaaattttggcattccatgtgaacttcggataaca
tctgcccataaaggaccagatgaaactctgaggattaaagcagagtatgaaggggatggc
attcctactgtatttgtggcagtggcaggcagaagcaacggtttaggaccagtgatgtct
ggtaacactgcatatccagttatcaactgccctccactcactccagactggggagctcag
gatgtgtggtcttctcttcgactacccagtggtcttggctgttcaaccatactttctcca
gaaggatcagctcagtttgctactcagatatttggattaaacaaccatttggtatgggct
aaactgcgagcaagtatattgaacacatggatttccttgaagcaggctgacaagaaaatc
cgagagggcaatttataa

DBGET integrated database retrieval system