KEGG   Ailuropoda melanoleuca (giant panda): 100482691Help
Entry
100482691         CDS       T01329                                 

Definition
m-phase inducer phosphatase 3-like
Orthology
K05867  
M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100482691
   04114 Oocyte meiosis
    100482691
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100482691
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100482691
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100482691
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100482691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 476 aa AA seqDB search
MSAEFISSAGQEGRPSSGPSFRSSRRKILNLLLERDTSFTTCSDIPRTPVNKLFGDSANL
SVLSGGTPKCCLDLSNLSGGGEMSANQLNTSIDLDETGHLDSKGPQEIHLTGMNHQQHLT
KCSPAQLRCSTPNTLDHGNRKKDAVCSSSTNKENDNENFLESEMKYMGSPIITLHKLDKN
TELGEDQAEISNELMEFSLEDQEEAKASPNRSSLYRSPSLPENLNRPRLKQVVKFKDNPI
PDKEKKEYCSSHKELRKGLGLKKTVSLCDINITQMLEEDSNQGSLIGDFSKVCVLPTVSG
RHQDLKYITPETVAALLSGKFQSLIEKFYIIDCRYPYEYLGGHIQGALNLYSQEELYNFF
LKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRSLREEDRVLNQYPALYYPELYILKGGYR
DFFPEYTELCEPQSYCPMHHQDHKAELLRCRSQSKAWEGERQLQEQIALLVKDVSP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagaattcatttcatctgcaggacaggagggacgccccagctcaggacccagt
tttagatccagtcggagaaagatattaaacctcctcctggagagagacacttcctttact
acctgttcagatatccctagaactccagtgaacaaactctttggtgattctgcaaaccta
agcgtgttgtctggaggaaccccaaaatgttgccttgatctttcgaatcttagcggtggt
ggagagatgtctgccaatcaacttaacacttccatagaccttgatgaaactggtcacttg
gattctaaaggacctcaggaaatacatttaactgggatgaatcatcaacagcaccttaca
aaatgcagcccagcacagctgcgttgtagcactccaaatactttggaccatggcaacaga
aagaaagatgcagtatgtagctcatccacaaataaagaaaatgacaatgaaaactttttg
gaaagtgaaatgaaatatatggggagtcccattattacacttcacaaattggataaaaat
acagaactaggagaagatcaggcagagatttccaatgaattgatggagttttctctggaa
gatcaagaagaggccaaggcatctccgaatagaagctccttgtatcgctccccttcattg
ccagagaatttgaaccggccaagactgaagcaggtggtaaaattcaaggacaatccaata
ccagataaagaaaaaaaggaatattgttctagccacaaagagctcaggaagggcttaggt
ctaaagaagacagtctctctgtgtgacattaatatcactcagatgctggaggaagattct
aaccagggttctctgattggtgatttctccaaggtatgtgtgctgccaaccgtgtcaggg
agacaccaagatctgaagtacatcaccccagaaacagtggctgccttactgtcagggaag
ttccagagtctgattgagaagttttatattatcgattgccgctatccatacgagtacctg
ggaggacacatccagggagccttaaacttgtacagtcaggaagaactgtataacttcttt
ctgaagaagcccattgtccctctggacacccagaaaagaataatcatcgtgttccactgt
gaattctcctcagagaggggtccccgaatgtgccgctctctgagagaagaggacagggtt
ctgaaccagtatcctgcattgtactacccagaactatatatcctcaaagggggctacaga
gacttctttccggaatatacggagctgtgtgaaccacagagctactgccctatgcatcat
caagaccataaggctgagctgctgaggtgtcgaagccagagcaaagcatgggaaggagag
cggcagctgcaggagcagattgccttactggtgaaggatgtgagcccatga

DBGET integrated database retrieval system