KEGG   Ailuropoda melanoleuca (giant panda): 100482691Help
Entry
100482691         CDS       T01329                                 

Definition
m-phase inducer phosphatase 3-like
Orthology
K05867  
M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
MicroRNAs in cancer
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:aml04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:aml04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:aml04914]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:aml05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 476 aa AA seqDB search
MSAEFISSAGQEGRPSSGPSFRSSRRKILNLLLERDTSFTTCSDIPRTPVNKLFGDSANL
SVLSGGTPKCCLDLSNLSGGGEMSANQLNTSIDLDETGHLDSKGPQEIHLTGMNHQQHLT
KCSPAQLRCSTPNTLDHGNRKKDAVCSSSTNKENDNENFLESEMKYMGSPIITLHKLDKN
TELGEDQAEISNELMEFSLEDQEEAKASPNRSSLYRSPSLPENLNRPRLKQVVKFKDNPI
PDKEKKEYCSSHKELRKGLGLKKTVSLCDINITQMLEEDSNQGSLIGDFSKVCVLPTVSG
RHQDLKYITPETVAALLSGKFQSLIEKFYIIDCRYPYEYLGGHIQGALNLYSQEELYNFF
LKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRSLREEDRVLNQYPALYYPELYILKGGYR
DFFPEYTELCEPQSYCPMHHQDHKAELLRCRSQSKAWEGERQLQEQIALLVKDVSP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagaattcatttcatctgcaggacaggagggacgccccagctcaggacccagt
tttagatccagtcggagaaagatattaaacctcctcctggagagagacacttcctttact
acctgttcagatatccctagaactccagtgaacaaactctttggtgattctgcaaaccta
agcgtgttgtctggaggaaccccaaaatgttgccttgatctttcgaatcttagcggtggt
ggagagatgtctgccaatcaacttaacacttccatagaccttgatgaaactggtcacttg
gattctaaaggacctcaggaaatacatttaactgggatgaatcatcaacagcaccttaca
aaatgcagcccagcacagctgcgttgtagcactccaaatactttggaccatggcaacaga
aagaaagatgcagtatgtagctcatccacaaataaagaaaatgacaatgaaaactttttg
gaaagtgaaatgaaatatatggggagtcccattattacacttcacaaattggataaaaat
acagaactaggagaagatcaggcagagatttccaatgaattgatggagttttctctggaa
gatcaagaagaggccaaggcatctccgaatagaagctccttgtatcgctccccttcattg
ccagagaatttgaaccggccaagactgaagcaggtggtaaaattcaaggacaatccaata
ccagataaagaaaaaaaggaatattgttctagccacaaagagctcaggaagggcttaggt
ctaaagaagacagtctctctgtgtgacattaatatcactcagatgctggaggaagattct
aaccagggttctctgattggtgatttctccaaggtatgtgtgctgccaaccgtgtcaggg
agacaccaagatctgaagtacatcaccccagaaacagtggctgccttactgtcagggaag
ttccagagtctgattgagaagttttatattatcgattgccgctatccatacgagtacctg
ggaggacacatccagggagccttaaacttgtacagtcaggaagaactgtataacttcttt
ctgaagaagcccattgtccctctggacacccagaaaagaataatcatcgtgttccactgt
gaattctcctcagagaggggtccccgaatgtgccgctctctgagagaagaggacagggtt
ctgaaccagtatcctgcattgtactacccagaactatatatcctcaaagggggctacaga
gacttctttccggaatatacggagctgtgtgaaccacagagctactgccctatgcatcat
caagaccataaggctgagctgctgaggtgtcgaagccagagcaaagcatgggaaggagag
cggcagctgcaggagcagattgccttactggtgaaggatgtgagcccatga

DBGET integrated database retrieval system