KEGG   Ailuropoda melanoleuca (giant panda): 100482745Help
Entry
100482745         CDS       T01329                                 

Definition
acrosin-like
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     100482745
Peptidases [BR:aml01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100482745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 389 aa AA seqDB search
MVEMLPTAVLLVLAVSVVAKDNATCDGPCGLRFRQNPQGSGRIVGGQDAMIGAWPWMVSL
QVFTSHNNRRYHACGGTLLNSHWLLTAAHCFVSKKKVYDWRLIFGAREIVYGNDKPAKPP
QQERYVEKIIMHEKYVPSLEHNDIALVKITPPVPCGQFIGPGCLPQFREGPPRVPQACWV
AGWGFLKEKAYRIAPTLQEARVNLIDLGLCNSTQWYNGRIRSTNACAGYPEGKIDTCQGD
SGGPLMCRDNVANTYVVVGITSWGVGCARAKRPGVYTATWPYLNWIASKIGSNALYMAQL
PTPPRPTSQAPPARPPSARPSSRPPWYFQRPPRPXPPPVPPPITKPPQALSFAKRLQQLI
EILKGKAFSSTKGYYEMETTDVPELTAVS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggtggagatgctgccaactgccgttctgctggtcttggcagtgtctgtggttgccaaa
gataacgccacgtgtgatggcccctgtgggttacggttcaggcagaacccacaggggagt
ggccggatcgtcggagggcaggatgcaatgatcggggcctggccctggatggtcagcctg
caggttttcacctcccacaataaccgaaggtatcatgcatgcggaggcaccttgctgaac
tcccactggctgcttactgcagcacactgctttgtctccaaaaaaaaagtatacgactgg
agactgatttttggagcaagggaaattgtgtatgggaacgataagccagcgaagccacct
caacaggagagatatgtcgagaaaatcatcatgcacgagaaatacgtccccagcttagag
cacaatgacatcgccctcgtaaagatcacccctcccgttccctgcgggcagttcatcggg
ccgggctgcctgccccagttcagggagggcccgcctagagttccccaggcctgctgggtg
gctggctggggattcttgaaagagaaagcctacaggatcgcgccgacactgcaggaggca
cgtgtgaacctcatcgacctcggcttgtgcaactccacccagtggtacaacggccgcatc
cgttcaaccaatgcgtgtgcagggtaccctgaaggcaagatcgacacctgccagggggac
agcggcgggcctctcatgtgcagagacaacgtggcaaacacctatgtggtcgtgggaatt
acaagctggggggtaggctgtgcccgagctaagcgccctggagtctacacggccacctgg
ccctatctgaactggattgcttccaagatcggttctaatgccttgtacatggctcaactg
cccacccctccccgtccgacttctcaagcacccccggctagacccccctctgcccgccct
tcctctcgccctccttggtacttccaacgccctcctcgaccancacccccacccgtaccc
ccacctatcactaaacctccccaagcactttcttttgccaagcgactacagcaactcata
gagatcttgaaggggaaggccttttctagcacaaaggggtattacgaaatggagaccaca
gatgtcccagaactgaccgccgtctcctga

DBGET integrated database retrieval system