KEGG   Ailuropoda melanoleuca (giant panda): 100482768Help
Entry
100482768         CDS       T01329                                 

Gene name
PDIA5
Definition
protein disulfide isomerase family A, member 5
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100482768 (PDIA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 541 aa AA seqDB search
MVCIEQGLRNTSLPSYKEHEGAGVHPRDLELFKAEGVVLLVQLSSTKVSSLIEKISDPKD
LKKLLRTRNNVLVLYSKSEAAAESHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMK
VDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHIDS
EKDFRRLLKKEEKPLLMMFYAPWCGMCKRIMPHFQKAATQLRGHFVLAGMNVYPSEFENI
KEEYNVRGYPTICYFEKGRFLFQYDNYGSTAEDIVEWLKNPQPPQPQAPETPWADEGGSV
YHLTDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFENAAEVLHGEADSSGVLAAVDAT
VNKALAERFHISEFPTLKYFKNGEKYAVPALRTKKNFIEWMRNPEAPPPPEPTWEEQQTS
VLHLAGDNFRETLKKKKHTLVMFYAPWCPHCKKVIPHFTTTADVFKDDRKIACAAVDCVK
EKNQDLCQQEAVKAYPTFHYYHYGKFAEKYDSDRTELGFTNFIRTLREGDHERLGKKKEE
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggtctgcattgaacagggactccgtaacaccagcctccccagctacaaagaacatgag
ggtgctggcgtgcaccccagagatctggagctttttaaagctgagggtgtggtcctgttg
gtgcagctgtcctccacaaaggtctcctcactcatcgagaaaatttctgaccccaaggac
ttgaaaaaacttctcaggacccggaataatgtgctggtgctgtactccaaatctgaggct
gcagctgaaagtcatctcaggttattatccactgtggcccaggccgtgaaaggacaaggc
accatctgctgggtcgactgtggtgatgccgagagtagaaaattgtgcaagaagatgaaa
gttgacctgagcccaaaggacaaaaaggttgaattattccattaccaggatggtgcattt
catactgaatataaccgagctgtgacatttaagtccatagtggcctttctgaaggatcca
aaaggccccccattgtgggaagaagatcctggagccaaagatgttgtccacattgacagt
gaaaaggacttcagacggctcctgaagaaggaagagaagccactcctgatgatgttttat
gctccctggtgcggcatgtgcaagaggataatgccacatttccagaaggctgcgacccag
ctgcgaggccacttcgtgttggctgggatgaacgtctacccctcagaatttgagaacatc
aaggaggagtataatgtgcgaggctaccccaccatctgctatttcgagaaaggacggttt
ctgttccagtatgacaactatgggtccacagctgaggacattgtggaatggctgaagaat
ccacagccgccacagccccaggcccccgagactccctgggcagatgagggcggctccgtt
tatcacctgaccgatgaagactttgaccagtttgtgaaggaacactcctctgtcctcgtc
atgttccatgccccatggtgtggacactgtaagaaaatgaagccagagtttgagaatgca
gcagaagtcctccacggagaagcagacagctctggtgtccttgcagctgtcgatgccact
gtcaacaaggccctggccgagagattccacatctccgagtttcctacactgaagtatttt
aagaacggagagaagtacgcagtgcctgcactcagaacaaagaagaactttattgagtgg
atgcgaaaccctgaggcccctccacccccagagcccacctgggaagagcagcagaccagc
gtgttgcacctggcgggggacaacttccgggagaccctgaagaagaagaaacacaccttg
gtcatgttctacgccccttggtgcccgcactgtaagaaggtcatcccacactttaccacc
accgccgacgtcttcaaagatgaccgaaagattgcctgtgctgctgtggactgcgtcaaa
gagaagaaccaggacctgtgtcagcaggaggccgtcaaggcttaccccacgttccactac
taccactatgggaagtttgcagagaagtatgacagtgatcggacggaattggggtttacc
aattttattcgaacgctccgggaaggagaccatgagagactagggaagaagaaggaagag
ttgtaa

DBGET integrated database retrieval system