KEGG   Ailuropoda melanoleuca (giant panda): 100482804Help
Entry
100482804         CDS       T01329                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100482804
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100482804
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100482804
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100482804
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100482804
  Exosomal proteins of breast milk
   100482804
Heparan sulfate/heparin binding proteins [BR:aml00536]
 Enzymes (General comment) Variety
  100482804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 478 aa AA seqDB search
MESKALFLVALGMWLQSLTATRGGVAAADRITGGREFIDIESKFALRTPEDTAEDTCHLI
PGVTESVANCHFNHSSKTFVVIHGWTVTGMYENWVPKLVAALYKREPDSNVIVVDWLLRA
QQHYPVSAGYTKLVGKDVAKFINWMAEEFHYPLDNVHLLGYSLGAHAAGIAGSLTNKKVN
RITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGG
TFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAF
EKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESDTQ
TNQAFEISLYGTVAESENIPFTLSEVSANKTYSFLIYTEVDIGELLMLKLKWKSDSYFSW
SDWWSSPGFAIEKIRVKAGETQKKVIFCSREKVSHLQKGKASVVFVKCHDKSLNNKSG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagcactgttcctggtggccctcggcatgtggctccagagtctgaccgcc
acccgcggaggggtggccgccgccgacagaattacaggaggaagagagtttatagatatt
gaaagtaaatttgctctaaggacccctgaagacacagctgaggatacttgccacctcatt
cctggagtgacagaatctgtggctaactgccacttcaaccacagcagcaaaacctttgtg
gtgattcatggctggacggtgacaggaatgtatgagaactgggtgccaaaacttgtggct
gccctgtacaagagggaaccagactccaatgtcattgtggtggactggctgttgcgggcc
cagcagcattatccagtgtctgcagggtacaccaagctggtgggaaaagatgtggccaag
ttcatcaactggatggcggaggaatttcactatcctctggacaatgtccatctcttggga
tacagccttggagcccacgctgctggcattgcaggaagtctgaccaataagaaggtcaat
agaattactggcctagatccagctggacctaactttgaatatgcagaagctccaagtcgc
ctttctcccgatgatgcagattttgtagacgtcttacacacattcaccagagggtcgcct
ggccgaagtattggaatccagaaaccagtaggacatgttgacatttatcctaatggaggc
acttttcaacctggatgtaacattggggaagctatccgtgtgattgcagagagaggcctt
ggagatgtggaccagctagtgaagtgttcccatgagcgctccattcatctctttattgac
tctctgttgaatgaagaaaatccaagcaaggcctaccggtgcaattcaaaggaagccttt
gagaaagggctctgcctgagttgcagaaagaaccgttgcaacaacttgggctatgagatc
aataaggtcagagccaaaagaagcagcaaaatgtacctgaagactcgctctcagatgcct
tacaaagtcttccattaccaagtaaagatacatttttccgggactgagagtgatacacag
accaaccaggcctttgagatctctctgtatggcactgtggctgagagtgagaacatccct
tttaccctgtctgaagtttctgcgaataagacatactcctttctaatttacacggaggtg
gatattggggaactgctaatgttgaaactcaaatggaagagtgattcatacttcagctgg
tcagactggtggagcagccctggctttgctattgagaagatcagagtaaaagcaggagag
actcaaaaaaaggtaatcttctgttccagggagaaagtatctcatctgcagaaaggaaag
gcatctgtggtatttgtgaaatgccatgacaagtctctgaataacaagtctggctga

DBGET integrated database retrieval system