KEGG   Ailuropoda melanoleuca (giant panda): 100482804Help
Entry
100482804         CDS       T01329                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:aml00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:aml03320]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:aml05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 478 aa AA seqDB search
MESKALFLVALGMWLQSLTATRGGVAAADRITGGREFIDIESKFALRTPEDTAEDTCHLI
PGVTESVANCHFNHSSKTFVVIHGWTVTGMYENWVPKLVAALYKREPDSNVIVVDWLLRA
QQHYPVSAGYTKLVGKDVAKFINWMAEEFHYPLDNVHLLGYSLGAHAAGIAGSLTNKKVN
RITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGG
TFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAF
EKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESDTQ
TNQAFEISLYGTVAESENIPFTLSEVSANKTYSFLIYTEVDIGELLMLKLKWKSDSYFSW
SDWWSSPGFAIEKIRVKAGETQKKVIFCSREKVSHLQKGKASVVFVKCHDKSLNNKSG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagcactgttcctggtggccctcggcatgtggctccagagtctgaccgcc
acccgcggaggggtggccgccgccgacagaattacaggaggaagagagtttatagatatt
gaaagtaaatttgctctaaggacccctgaagacacagctgaggatacttgccacctcatt
cctggagtgacagaatctgtggctaactgccacttcaaccacagcagcaaaacctttgtg
gtgattcatggctggacggtgacaggaatgtatgagaactgggtgccaaaacttgtggct
gccctgtacaagagggaaccagactccaatgtcattgtggtggactggctgttgcgggcc
cagcagcattatccagtgtctgcagggtacaccaagctggtgggaaaagatgtggccaag
ttcatcaactggatggcggaggaatttcactatcctctggacaatgtccatctcttggga
tacagccttggagcccacgctgctggcattgcaggaagtctgaccaataagaaggtcaat
agaattactggcctagatccagctggacctaactttgaatatgcagaagctccaagtcgc
ctttctcccgatgatgcagattttgtagacgtcttacacacattcaccagagggtcgcct
ggccgaagtattggaatccagaaaccagtaggacatgttgacatttatcctaatggaggc
acttttcaacctggatgtaacattggggaagctatccgtgtgattgcagagagaggcctt
ggagatgtggaccagctagtgaagtgttcccatgagcgctccattcatctctttattgac
tctctgttgaatgaagaaaatccaagcaaggcctaccggtgcaattcaaaggaagccttt
gagaaagggctctgcctgagttgcagaaagaaccgttgcaacaacttgggctatgagatc
aataaggtcagagccaaaagaagcagcaaaatgtacctgaagactcgctctcagatgcct
tacaaagtcttccattaccaagtaaagatacatttttccgggactgagagtgatacacag
accaaccaggcctttgagatctctctgtatggcactgtggctgagagtgagaacatccct
tttaccctgtctgaagtttctgcgaataagacatactcctttctaatttacacggaggtg
gatattggggaactgctaatgttgaaactcaaatggaagagtgattcatacttcagctgg
tcagactggtggagcagccctggctttgctattgagaagatcagagtaaaagcaggagag
actcaaaaaaaggtaatcttctgttccagggagaaagtatctcatctgcagaaaggaaag
gcatctgtggtatttgtgaaatgccatgacaagtctctgaataacaagtctggctga

DBGET integrated database retrieval system