KEGG   Ailuropoda melanoleuca (giant panda): 100482804Help
Entry
100482804         CDS       T01329                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Cholesterol metabolism
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100482804 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100482804 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    100482804 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100482804 (LPL)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100482804 (LPL)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100482804 (LPL)
  Exosomal proteins of breast milk
   100482804 (LPL)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   100482804 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aml00537]
 Enzymes
  100482804 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 478 aa AA seqDB search
MESKALFLVALGMWLQSLTATRGGVAAADRITGGREFIDIESKFALRTPEDTAEDTCHLI
PGVTESVANCHFNHSSKTFVVIHGWTVTGMYENWVPKLVAALYKREPDSNVIVVDWLLRA
QQHYPVSAGYTKLVGKDVAKFINWMAEEFHYPLDNVHLLGYSLGAHAAGIAGSLTNKKVN
RITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGG
TFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAF
EKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESDTQ
TNQAFEISLYGTVAESENIPFTLSEVSANKTYSFLIYTEVDIGELLMLKLKWKSDSYFSW
SDWWSSPGFAIEKIRVKAGETQKKVIFCSREKVSHLQKGKASVVFVKCHDKSLNNKSG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagcactgttcctggtggccctcggcatgtggctccagagtctgaccgcc
acccgcggaggggtggccgccgccgacagaattacaggaggaagagagtttatagatatt
gaaagtaaatttgctctaaggacccctgaagacacagctgaggatacttgccacctcatt
cctggagtgacagaatctgtggctaactgccacttcaaccacagcagcaaaacctttgtg
gtgattcatggctggacggtgacaggaatgtatgagaactgggtgccaaaacttgtggct
gccctgtacaagagggaaccagactccaatgtcattgtggtggactggctgttgcgggcc
cagcagcattatccagtgtctgcagggtacaccaagctggtgggaaaagatgtggccaag
ttcatcaactggatggcggaggaatttcactatcctctggacaatgtccatctcttggga
tacagccttggagcccacgctgctggcattgcaggaagtctgaccaataagaaggtcaat
agaattactggcctagatccagctggacctaactttgaatatgcagaagctccaagtcgc
ctttctcccgatgatgcagattttgtagacgtcttacacacattcaccagagggtcgcct
ggccgaagtattggaatccagaaaccagtaggacatgttgacatttatcctaatggaggc
acttttcaacctggatgtaacattggggaagctatccgtgtgattgcagagagaggcctt
ggagatgtggaccagctagtgaagtgttcccatgagcgctccattcatctctttattgac
tctctgttgaatgaagaaaatccaagcaaggcctaccggtgcaattcaaaggaagccttt
gagaaagggctctgcctgagttgcagaaagaaccgttgcaacaacttgggctatgagatc
aataaggtcagagccaaaagaagcagcaaaatgtacctgaagactcgctctcagatgcct
tacaaagtcttccattaccaagtaaagatacatttttccgggactgagagtgatacacag
accaaccaggcctttgagatctctctgtatggcactgtggctgagagtgagaacatccct
tttaccctgtctgaagtttctgcgaataagacatactcctttctaatttacacggaggtg
gatattggggaactgctaatgttgaaactcaaatggaagagtgattcatacttcagctgg
tcagactggtggagcagccctggctttgctattgagaagatcagagtaaaagcaggagag
actcaaaaaaaggtaatcttctgttccagggagaaagtatctcatctgcagaaaggaaag
gcatctgtggtatttgtgaaatgccatgacaagtctctgaataacaagtctggctga

DBGET integrated database retrieval system