KEGG   Ailuropoda melanoleuca (giant panda): 100482855Help
Entry
100482855         CDS       T01329                                 

Definition
mitogen-activated protein kinase 15-like
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100482855
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100482855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 553 aa AA seqDB search
MCAAEVDHHVAQRYLLKRRLGKGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFR
EIMLLQELGDHPNIIRLLDVIRAENDRDIYLVFESMDTDLNAVICKGKLLRDVHKRYIIY
QLLRATKFIHSGRVIHRDQKPSNILLDSSCLVKLCDFGLARSLSGLPEGPEGQALTDYVA
TRWYRAPEVLLSSSWYTPGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSK
EDLLALGSSYSASILPCLGSRPRQTLDTLLPSDTPPEALDLLRRLLVFAPDKRLSAAQAL
QHPYVQRFHCPAREWSXAVRLPVLEGVQLSAPEYRSRVYQMVLERRGNSCVPRDKGLGST
APGAQPSAPWSQAPLLKSRVIPQPAPGSPPQNSGRSPGHQRAHDMACGAKNLPRQSSAPL
LQPPPPGGLGRGERPPGATAEAPSAPSWVKPSGKGAAPSLASQAAAQVAIQALIRSDWNP
GRGVRATGARRVPRGLPADVRPAPRPGRRMFSASASQGAQGAARAALGGYSQAYGTVCHS
ALGRLPLLPGPRA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgccgcggaggtggaccaccacgtagcccaacgatacctgcttaagcggcggctg
gggaagggggcctatggcatcgtgtggaaggcagtggataggaggactggcgaggtcgtg
gccatcaagaagatcttcgatgcctttagagataagacggatgcccagagaacgttccgg
gaaatcatgctgctccaggaacttggggaccatcccaacatcatccgcctcctggatgtg
atccgggcagagaatgacagggacatttacctggtgtttgagtctatggacactgacctg
aacgccgtcatctgcaagggcaagctgctgagggacgtccacaagcgttacatcatctac
cagctcctacgggccaccaagttcatccactcaggacgtgtcatccaccgagaccagaag
ccatccaacatcctcctggactccagctgcttggtgaagctctgtgactttggtcttgct
cgctccctcagtggcctccctgaggggcctgagggccaggccctgacagattacgtggcc
acacgctggtaccgggctcccgaggtgctgctgtcctctagctggtacacccctggggtg
gacatgtggagtctgggctgcatcctgggggagatgcttcgggggaggcccctgttcccc
ggcacatccacgctgcaccagctggagctgatcctagagaccatcccaccgccatccaag
gaggacctcctggctcttggctcaagctacagtgcctcgatcctgccctgcctggggtcc
cggccacggcagacgctggacaccctcctgccgtcagacacacccccggaggccttggat
ctcctcaggaggctcctggtatttgccccggacaagcggcttagcgcggcccaggcactg
cagcacccctacgtgcagaggttccactgcccggcccgtgagtggagtncggctgtgcgg
ctcccggtgcttgaaggagttcagctctcagccccggagtatcgcagccgtgtctatcag
atggtcctggagcgcaggggcaacagctgcgtccccagagacaagggcctggggagcaca
gcccccggcgcacagcccagtgccccctggtcccaggcacccctgctcaaatccagagtc
atcccgcagccggccccgggctcgcccccgcagaactccggacgcagccccggtcaccag
cgcgcgcacgacatggcctgcggagccaagaaccttccgcggcagagctcggcccccctg
ctccagcctccgcccccaggaggtctcgggagaggggagaggccccctggggcgacggcg
gaggccccctcggcaccctcgtgggtgaagcccagcgggaagggggcggcgccctccctg
gcttcccaggccgccgcccaggtggccatccaggccctcatccggagcgactggaatccg
ggccgtggggtgagggcgaccggcgcgcgacgggtccctcgcgggcttcccgcggatgtc
cggcccgcgccccggcccggccggaggatgttcagcgcctcggcctcgcagggggcccag
ggcgccgcaagggctgctctcgggggctactctcaagcctacgggaccgtctgccactcg
gcgctgggccgcctgcccctgctcccggggccccgagcgtaa

DBGET integrated database retrieval system