KEGG   Ailuropoda melanoleuca (giant panda): 100482939Help
Entry
100482939         CDS       T01329                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
Cellular senescence
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Adherens junction
Th17 cell differentiation
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Chagas disease (American trypanosomiasis)
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Hepatocellular carcinoma
Gastric cancer
Module
TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100482939 (TGFBR2)
   04350 TGF-beta signaling pathway
    100482939 (TGFBR2)
   04390 Hippo signaling pathway
    100482939 (TGFBR2)
   04068 FoxO signaling pathway
    100482939 (TGFBR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100482939 (TGFBR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100482939 (TGFBR2)
  Cell growth and death
   04218 Cellular senescence
    100482939 (TGFBR2)
  Cellular community - eukaryotes
   04520 Adherens junction
    100482939 (TGFBR2)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    100482939 (TGFBR2)
  Endocrine system
   04926 Relaxin signaling pathway
    100482939 (TGFBR2)
  Development
   04380 Osteoclast differentiation
    100482939 (TGFBR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100482939 (TGFBR2)
   05202 Transcriptional misregulation in cancers
    100482939 (TGFBR2)
   05210 Colorectal cancer
    100482939 (TGFBR2)
   05212 Pancreatic cancer
    100482939 (TGFBR2)
   05225 Hepatocellular carcinoma
    100482939 (TGFBR2)
   05226 Gastric cancer
    100482939 (TGFBR2)
   05220 Chronic myeloid leukemia
    100482939 (TGFBR2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100482939 (TGFBR2)
  Infectious diseases
   05166 HTLV-I infection
    100482939 (TGFBR2)
   05142 Chagas disease (American trypanosomiasis)
    100482939 (TGFBR2)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100482939 (TGFBR2)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   100482939 (TGFBR2)
Enzyme-linked receptors [BR:aml01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   100482939 (TGFBR2)
Cytokine receptors [BR:aml04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   100482939 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 587 aa AA seqDB search
MFSPPVWSEDGHREWLSSFPQNPEPAHGSSRAFSAAGCFSCTQREFSSSGNFNNDMMVTD
NNGVIKFPQLCKFCDVRSSTCDNQKSCVSNCSITSICEKPHEVCLAVWRKNDENITLETL
CHDPKDTYHGIVLEDSASPKCIMKEKKVLGETFFMCSCSSDECNDYIIFSEEYATNNPDL
LLVIFQVTGISLLPPLGIAIAVIVTFYCYRVHRQQKLSPSWETSKPRKLMEFSEHLAIIL
EDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFP
YEEYASWKTEKDIFSDINLKHENVLQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRH
VISWEDLRKLGSSLARGIAHLHSDHTLCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGL
SLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSR
CNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSSWLNHQGIQTVCETLTEC
WDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcccacccgtttggtcagaggatggacacagagagtggttgagtagctttccg
cagaaccccgagccagctcacggttcatccagagccttctctgctgcaggctgcttctcc
tgtacccagcgtgaattctcctccagtggaaattttaataatgacatgatggtcactgac
aacaatggtgtcatcaaatttccacaattgtgtaaattttgcgatgtgagatcttccacc
tgtgacaatcagaaatcctgcgtgagcaactgcagcattacatccatctgtgagaagcca
catgaagtctgtctggcggtctggagaaagaatgatgagaacataacactggagacgctt
tgccatgaccccaaggacacctaccacggaatcgttctcgaagattctgcttctccaaag
tgtattatgaaggaaaaaaaggtgttgggcgagactttctttatgtgttcctgtagctcc
gacgagtgcaatgactacatcatcttctcggaagaatatgccaccaacaaccctgacctg
ttgttagtcatattccaagtgacaggcatcagcctcctaccaccactgggaatcgccata
gccgtcatcgtcaccttctactgctaccgggttcaccggcagcagaagctgagcccgtcc
tgggagaccagcaagccgcggaagctcatggagttcagcgagcacctggccatcattctg
gaagacgaccgctccgacatcagctctacctgcgccaacaacatcaaccacaacacagag
ctgctgcccattgagctggacaccctggtggggaaaggtcgcttcgccgaggtctacaag
gccaagctgaagcagaacacttcagaacagttcgagaccgtggcggtcaagatcttccct
tatgaggagtacgcctcctggaagacagagaaggacatcttctcagacatcaacctgaag
catgagaacgtcctgcagttcctgacggccgaggagcggaagacagagctgggcaagcag
tactggctgatcacagccttccacgccaagggcaacctacaggagtacctcacgcggcac
gtcatcagctgggaggacctgcgcaagctgggcagctccctcgcccggggcatcgctcac
ctgcacagcgaccataccctgtgcgggaggcccaagatgcccattgtgcacagggacctc
aagagctccaatatcctcgtcaagaacgacctgacctgctgcctgtgtgactttgggctt
tccctgcgcctcgacccgactctgtctgtggatgacctggccaacagtgggcaggtggga
actgcaagatacatggctccagaagtcctagagtccaggatgaatctggagaacgttgaa
tcctttaagcagacggatgtctactccatggctctggtactctgggaaatgacatcgcgc
tgcaatgcggtgggagaagtgaaagattacgagcctccatttggttccaaggtgcgggag
catccttgtgttgagagcatgaaggacaacgtgctgagagaccgagggcgaccagaaatt
cctagctcctggctcaaccaccagggcatccagaccgtgtgcgaaactctgaccgagtgc
tgggaccacgacccggaggcccggctcacggcccagtgcgtggcggagcgcttcagcgaa
ctggagcacctggacaggctctcagggaggagctgctccgaggagaagattcccgaagat
ggctcgctgaacactaccaaatag

DBGET integrated database retrieval system