KEGG   Ailuropoda melanoleuca (giant panda): 100482969Help
Entry
100482969         CDS       T01329                                 

Gene name
PPOX
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  
protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100482969 (PPOX)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     100482969 (PPOX)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     100482969 (PPOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 500 aa AA seqDB search
MGRTVVVLGGGISGLAASYHLSRAPCPPKTLYPATIGRAACLPPVPRWSWWRAASVWEAG
SARSEGQVALSLNLDLEEFGRPEPWEPGRCSWMYGEQVSELGLDSEVLPVRGDHPAAQNR
FLYVGGALHALPSGLRGLFRPSPPFSKPLFWAGLKELTAPRGKDPDETVHSFAQRRLGPE
VASLAMDSLCRGVFAGNSRELSIRSCFPSLFQAEQTHRSVLLGLLLGAGQSPQPDSALIR
RARAERWSQWSLRGGLETLPQALNTHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLGDSSL
EADHVISAVPASVLSRLLPAQAAPLARALSTIPAVSVAVVNLQYQAARLPVQGFGHLVPS
SEDPGVLGIVYDSVAFPEQDGSPPGLRVTVMLGGSWLQTLEARGTVLSQELFQQQAQQAA
AAQLGLKGPPSHCLVHLHKNCIPQYTLGHWQKLEAATQFLASQRLPLTLAGASYEGVAVN
DCIESGRQAAARVLGSEPNS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaccgtggtcgtgctgggcggtggcatcagcggcttggccgccagttaccac
ctgagccgggccccctgtccccccaagaccctttaccctgcgacaataggccgtgcagcg
tgtctccctcctgtccccaggtggtcctggtggagggcagcgagcgtctgggaggctgga
tccgctcggtccgagggccaggtggcgctatctttgaacttggacctcgaggaattcggc
cggccggagccctgggagcccggacgctgctcctggatgtatggagagcaggtttctgag
cttggcttggactcagaagtgttgcctgtccggggagaccacccagctgcccagaacagg
ttcctgtatgtaggtggtgccctgcatgcgctgccctctggcctcagggggctcttccgc
ccttcacctcccttctccaaacctctgttttgggctgggctgaaggagttgaccgcgccc
aggggcaaagaccctgatgagactgtgcacagttttgcccagcgccgccttggacctgag
gtggcgtctctagccatggacagtctctgccgaggagtgtttgcaggcaacagccgggag
ctcagcatcaggtcctgctttcccagtcttttccaagctgagcaaacccatcgttccgtt
ttactggggctgctgctgggggcagggcagagcccacagccggactcagcgctcattcgc
cgggcccgagctgagcgttggagccagtggtcactgcgtggagggctggaaacgttgccc
caggcccttaacacacacctgactagtaggggtgtcagtgttctccgaggccagcctgtc
tgcggactcagcctccaggcagaagggcgctggaaggtgtctctaggggacagcagtctg
gaggcagaccacgtgattagcgctgttccagcttcagtgctcagcaggctgctccccgcc
caggctgcacccctggctcgcgccctgagcaccatccctgccgtgtctgtggccgtggtg
aacctccagtaccaagcagcgcgtctgcccgtgcagggatttggacatttggtgccatcc
tcagaagacccaggcgtcctgggaattgtgtatgactcagttgcttttcctgagcaggac
gggagcccccctggcctccgagtgactgtgatgctgggagggtcctggttacagacgctg
gaagccaggggcactgtcttatctcaggagctgttccaacagcaggcacagcaagcagcg
gccgcccagttaggactaaaggggccaccaagtcactgcttggtccaccttcacaagaac
tgcatcccccagtatacactgggccactggcaaaaactggaggcagcgacccagttcctg
gcttctcagaggctgcccttgactctggccggagcctcctatgagggggttgctgtcaat
gactgtatagagagtggacgccaggcagcagcccgggtcctgggctcagagcctaacagc
tga

DBGET integrated database retrieval system