KEGG   Ailuropoda melanoleuca (giant panda): 100483003Help
Entry
100483003         CDS       T01329                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 2-like
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100483003
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100483003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 564 aa AA seqDB search
MQTNRIFKGVVGVDLDNIPSYSRLLSAFQIGGSKHTMNDHLHVSSHSHGQIQVQQLFEDN
SNKRTVLTTQPNGLTAVGKAGLPGVPERQLESIHRRQGSSTSLKSMEGMGKVKATPMTPE
QAMKQYMQKLTTFEHHEIFSYPEIYFLGPNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDH
VAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQD
KDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLD
ALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGA
RYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVS
SKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLE
WDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLR
TNLAQMTDANGNIQQRTVLPKLVS
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaaatcggatttttaaaggtgtggtgggagttgacttggataatatcccatcc
tactcacggttgctttctgctttccagattggcggcagtaagcacacgatgaatgatcac
ttacacgtcagcagccacagccacggacagatccaggtacagcagctgttcgaggataac
agtaacaagcggacagtgctcacgacacagcccaatgggctcaccgcagtggggaaagcg
ggcttgccgggggtgcccgagcggcagctggagagcatccacagacggcaggggagctcc
acgtctctgaagtccatggaaggcatggggaaggtgaaagccacccccatgacccctgaa
caagcaatgaagcaatacatgcaaaaactaaccaccttcgaacaccatgagattttcagc
taccctgaaatctatttcttgggtccaaatgcaaagaagcgccagggcatgacgggcggg
cccaacaacggaggctatgatgacgaccagggatcctacgtgcaggtgccccacgatcac
gtggcttacaggtacgaggtcctcaaggtcatcgggaagggaagctttgggcaggtggtc
aaggcctacgaccacaaagtccaccagcacgtggccctgaagatggtgcggaacgagaag
cgtttccaccggcaggcggcagaggagatccggatcctggaacacctgcggaagcaggac
aaggacaacaccatgaacgtcatccacatgctggagaacttcacgttccggaaccacatc
tgcatgacgttcgagctgctgagcatgaacctctacgagctcatcaagaagaataagttc
cagggcttcagcctgcctctggtgcgcaagtttgcccactcgattctgcagtgcttggat
gctctgcacaagaacagaatcattcactgtgacctcaagcccgagaacattttattaaag
cagcagggtcgaagcgggattaaagtgatcgactttggctccagttgttacgagcatcag
cgtgtctacacgtacattcagtcccgtttttaccgggctccggaagtgatccttggcgcc
agatacggcatgcccatcgatatgtggagcctgggttgcattttagcagagctcctgact
ggttaccccctcttgcctggggaagatgaaggggaccagctggcttgtatgattgaactc
ttgggcatgccctcccagaaactgctggatgcatccaaacgagccaaaaattttgtgagc
tccaagggttacccccgttactgcactgtcacaactctctcagacggctctgtggttctc
aacggaggccgttcccggagggggaaactgaggggcccaccagagagcagagagtggggg
aatgcactgaaggggtgtgacgatcccctcttccttgacttcttaaaacagtgtttagaa
tgggaccctgcggtccgcatgacccctggccaggctttgcggcacccctggctgcggagg
cggttgccgaagcctccgacgggggagaagacgtccgtgaagaggataaccgagagcact
ggtgctatcacatccatttccaagttacctccaccttccagctcagcttccaaactgagg
actaatttggcacagatgacagatgccaatgggaatattcagcagaggacagtgttgcca
aaacttgttagctga

DBGET integrated database retrieval system