KEGG   Ailuropoda melanoleuca (giant panda): 100483103Help
Entry
100483103         CDS       T01329                                 

Definition
ubiquitin carboxyl-terminal hydrolase 4-like
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1000 aa AA seqDB search
MAELDRERDAEQPPRGSARKHAVREADVRAGWAGGGGGEGGGSRERPDAETQKSELGALM
RTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGPIDNSGLFSDPESQTLK
EHLIDELDYVLVPAEAWNKLLNWYGCVEGQQPIVRKVVEHGLFVKHCKVEVYLLELKLCE
NSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTVQD
AGLYQGQVLVIEPQNEDGTWPRQTLQSKSSTAPSRNFPTSPTSSASPFSSVSASPIANGD
STNTSGMHSSGVSRGGSGFSASYNCQESPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTA
PLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDSHVAPRMFKTQVGRFAP
QFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDANGRPDAVVAKEAWENHRLRND
SVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRVMEVFLVPADPRCRPTQ
YRVVVPLMGAVSDLCEALSRLSGVAAENMVVTDVYNHRFHKIFQMDEGLNHIMPRDDIFV
YEVCGTSADGSECVTLPVYFRERKSRPSNTSSGAVLYGQPLLVSVAKHKLTLESLYQAVC
ERISRYIKQPLPEESGSSSSEPGACNGSRGNYEGEDEEEMEHQEEGRELLSETEGSGEDE
VGGDHGETTQKKVKGQPCPKRLFTFSLVNSYGTADINSLATDGKLLKLNSRSTLAIDWDS
ETRSLYYDEQESEAYEKHVSMLQPQKKKKTAVALRDCIELFTTMETLGEHDPWYCPNCKK
HQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPVRALNMSEFVCDLSARPYM
YDLIAVSNHYGAMGVGHYTAYAKNKVNGKWYYFDDSSVSLASEDQIVTKAAYVLFYQRRD
DEFYKTPSVVGFPGSSEGGTSPGSSQQGRGDDEACSMDTN
NT seq 3003 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctagacagagaaagggatgcggaacaaccaccccgcggctccgcccgcaag
cacgccgtgcgcgaggcggatgtccgggccggctgggccgggggcggcggcggggaaggt
ggaggcagccgtgagcgaccggatgcggagacccagaaatccgagctcggagccttgatg
aggaccacgctccaacgaggggcgcagtggtatcttattgacagccggtggttcaagcag
tggaagaagtatgtgggtttcgacagctgggatatgtacaatgtgggtgaacataattta
tttcctggcccaatagataactccggactcttttcagatcctgagagtcagaccttgaaa
gaacatttaattgatgaattggactatgtattggtcccagcagaggcctggaataaatta
ctaaactggtatggctgtgtagaaggccagcagcccattgtcagaaaagtggtggaacat
ggcctgtttgtcaagcactgcaaggtggaggtgtatttgctggaactgaagctctgtgaa
aatagcgaccccaccaatgtgctgagttgccatttcagcaaggcagacaccatcgcaacc
atcgaaaaggagatgcggaagctgttcaatatccctgctgagcgtgaaacacggctgtgg
aacaaatacatgagcaacacctatgagcagctgagcaagctagacaacactgtccaggat
gctgggctctaccagggtcaggtgctagtaattgagccccaaaatgaagatggcacatgg
ccgaggcagaccttgcagtcaaaatcaagcactgcgcctagcagaaattttcctacctct
ccaacatcatcagcaagtcccttttcctcagtgtctgcctctcccattgcaaatggtgat
agcactaacacctctgggatgcacagctctggtgtcagcagaggtggatctggcttctct
gcttcgtataattgtcaggagtccccctcgtctcacatacagcctggactctgcggactt
ggaaacctggggaacacctgcttcatgaactccgctttgcagtgcttgagcaacactgca
ccactgaccgactacttcctcaaagatgaatatgaggctgaaatcaacagagacaaccct
ctgggaatgaaaggggaaattgcagaagcctatgcagagctcattaaacagatgtggtct
ggaagggactctcacgtggcacctcgcatgttcaaaacccaagtgggacgtttcgcccct
cagttttctggctaccagcaacaagactcccaggagctgttagcctttcttctagacgga
ttgcatgaagatctgaaccgagtcaagaagaaaccctacctggagctgaaggatgccaat
gggcggccagatgcggtggtggcaaaggaagcctgggagaatcacaggttaaggaatgac
tctgtgattgtggacacattccacggcctcttcaaatccactttggtttgcccagaatgt
gctaaggtttctgtgacctttgacccattttgctatctaactctcccactgcccctgaag
aaagatagagttatggaggtctttctggttcctgctgaccctcgctgcagacctacccag
taccgtgtggttgtgccgctgatgggggccgtgtctgacctgtgcgaggctctttccagg
ctgtccggcgttgctgcggaaaacatggtggtcacagatgtatataatcaccggttccac
aaaattttccaaatggatgaaggtttaaaccacatcatgcctcgggatgacatttttgtg
tacgaggtctgcggcacctccgctgatggctctgagtgtgtcacgcttccagtctacttc
agggaaaggaagtccaggccgtcgaacacttcctccggggctgtgctatatgggcagccg
ctgctggtttctgttgccaagcacaagctgaccctcgagtctttgtaccaggctgtttgt
gaacgtatcagccgctatataaaacagcctttgcccgaggagtctggcagctcgtcctca
gagccgggggcctgcaacggctccaggggcaactatgaaggagaagacgaagaagaaatg
gagcatcaggaagaaggcagagagctgctttcagaaacagaaggcagtggggaggacgag
gtgggtggtgaccacggtgagaccacccaaaagaaggtcaaaggccagccctgcccgaaa
aggctttttaccttcagccttgtgaactcctatggaacagctgacataaattcccttgca
accgatggaaaactacttaaactcaactctcgatccacactggccatcgattgggacagt
gagacccggagcctttattatgatgagcaggagtctgaggcctacgagaagcacgtgagc
atgttacagcctcagaagaagaagaagacagccgtggccctgagggattgcatcgagctc
ttcaccaccatggagacccttggggagcatgacccctggtactgtcctaactgtaagaag
catcagcaggccactaagaagtttgacctttggtccttgccgaagatcctggtggttcac
ctcaaacgtttctcctacaatagatactggagggataagctcgacacagtcgtggaattc
ccagtcagagctctgaacatgtccgagtttgtgtgtgacctgtcggccaggccttacatg
tacgacctcattgctgtgtctaatcattacggagccatgggggttggccactacaccgca
tatgcgaagaacaaagtgaacgggaaatggtattattttgatgatagcagcgtgtccctg
gcctctgaggatcagatagtgacaaaagcagcttacgtgctgttttaccagcgtcgagat
gatgaattttataagacgccttcagtcgtcggttttcctggatcctctgagggagggacg
agcccaggcagctcacagcagggcaggggggacgatgaggcttgcagcatggacaccaac
tga

DBGET integrated database retrieval system