KEGG   Ailuropoda melanoleuca (giant panda): 100483103Help
Entry
100483103         CDS       T01329                                 

Gene name
USP4
Definition
(RefSeq) ubiquitin specific peptidase 4 (proto-oncogene)
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100483103 (USP4)
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100483103 (USP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 894 aa AA seqDB search
MRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGPIDNSGLFSDPESQTL
KEHLIDELDYVLVPAEAWNKLLNWYGCVEGQQPIVRKVVEHGLFVKHCKVEVYLLELKLC
ENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTVQ
DAGLYQGQVLVIEPQNEDGTWPRQTLQSNGSGFSASYNCQESPSSHIQPGLCGLGNLGNT
CFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDSHV
APRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDANGRPDAV
VAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRVME
VFLVPADPRCRPTQYRVVVPLMGAVSDLCEALSRLSGVAAENMVVTDVYNHRFHKIFQMD
EGLNHIMPRDDIFVYEVCGTSADGSECVTLPVYFRERKSRPSNTSSGAVLYGQPLLVSVA
KHKLTLESLYQAVCERISRYIKQPLPEESGSSSSEPGACNGSRGNYEGEDEEEMEHQEEG
RELLSETEGSGEDEVGGDHGETTQKKVKGQPCPKRLFTFSLVNSYGTADINSLATDGKLL
KLNSRSTLAIDWDSETRSLYYDEQESEAYEKHVSMLQPQKKKKTAVALRDCIELFTTMET
LGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPVRALN
MSEFVCDLSARPYMYDLIAVSNHYGAMGVGHYTAYAKNKVNGKWYYFDDSSVSLASEDQI
VTKAAYVLFYQRRDDEFYKTPSVVGFPGSSEGGTSPGSSQQGRGDDEACSMDTN
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccacgctccaacgaggggcgcagtggtatcttattgacagccggtggttcaag
cagtggaagaagtatgtgggtttcgacagctgggatatgtacaatgtgggtgaacataat
ttatttcctggcccaatagataactccggactcttttcagatcctgagagtcagaccttg
aaagaacatttaattgatgaattggactatgtattggtcccagcagaggcctggaataaa
ttactaaactggtatggctgtgtagaaggccagcagcccattgtcagaaaagtggtggaa
catggcctgtttgtcaagcactgcaaggtggaggtgtatttgctggaactgaagctctgt
gaaaatagcgaccccaccaatgtgctgagttgccatttcagcaaggcagacaccatcgca
accatcgaaaaggagatgcggaagctgttcaatatccctgctgagcgtgaaacacggctg
tggaacaaatacatgagcaacacctatgagcagctgagcaagctagacaacactgtccag
gatgctgggctctaccagggtcaggtgctagtaattgagccccaaaatgaagatggcaca
tggccgaggcagaccttgcagtcaaatggatctggcttctctgcttcgtataattgtcag
gagtccccctcgtctcacatacagcctggactctgcggacttggaaacctggggaacacc
tgcttcatgaactccgctttgcagtgcttgagcaacactgcaccactgaccgactacttc
ctcaaagatgaatatgaggctgaaatcaacagagacaaccctctgggaatgaaaggggaa
attgcagaagcctatgcagagctcattaaacagatgtggtctggaagggactctcacgtg
gcacctcgcatgttcaaaacccaagtgggacgtttcgcccctcagttttctggctaccag
caacaagactcccaggagctgttagcctttcttctagacggattgcatgaagatctgaac
cgagtcaagaagaaaccctacctggagctgaaggatgccaatgggcggccagatgcggtg
gtggcaaaggaagcctgggagaatcacaggttaaggaatgactctgtgattgtggacaca
ttccacggcctcttcaaatccactttggtttgcccagaatgtgctaaggtttctgtgacc
tttgacccattttgctatctaactctcccactgcccctgaagaaagatagagttatggag
gtctttctggttcctgctgaccctcgctgcagacctacccagtaccgtgtggttgtgccg
ctgatgggggccgtgtctgacctgtgcgaggctctttccaggctgtccggcgttgctgcg
gaaaacatggtggtcacagatgtatataatcaccggttccacaaaattttccaaatggat
gaaggtttaaaccacatcatgcctcgggatgacatttttgtgtacgaggtctgcggcacc
tccgctgatggctctgagtgtgtcacgcttccagtctacttcagggaaaggaagtccagg
ccgtcgaacacttcctccggggctgtgctatatgggcagccgctgctggtttctgttgcc
aagcacaagctgaccctcgagtctttgtaccaggctgtttgtgaacgtatcagccgctat
ataaaacagcctttgcccgaggagtctggcagctcgtcctcagagccgggggcctgcaac
ggctccaggggcaactatgaaggagaagacgaagaagaaatggagcatcaggaagaaggc
agagagctgctttcagaaacagaaggcagtggggaggacgaggtgggtggtgaccacggt
gagaccacccaaaagaaggtcaaaggccagccctgcccgaaaaggctttttaccttcagc
cttgtgaactcctatggaacagctgacataaattcccttgcaaccgatggaaaactactt
aaactcaactctcgatccacactggccatcgattgggacagtgagacccggagcctttat
tatgatgagcaggagtctgaggcctacgagaagcacgtgagcatgttacagcctcagaag
aagaagaagacagccgtggccctgagggattgcatcgagctcttcaccaccatggagacc
cttggggagcatgacccctggtactgtcctaactgtaagaagcatcagcaggccactaag
aagtttgacctttggtccttgccgaagatcctggtggttcacctcaaacgtttctcctac
aatagatactggagggataagctcgacacagtcgtggaattcccagtcagagctctgaac
atgtccgagtttgtgtgtgacctgtcggccaggccttacatgtacgacctcattgctgtg
tctaatcattacggagccatgggggttggccactacaccgcatatgcgaagaacaaagtg
aacgggaaatggtattattttgatgatagcagcgtgtccctggcctctgaggatcagata
gtgacaaaagcagcttacgtgctgttttaccagcgtcgagatgatgaattttataagacg
ccttcagtcgtcggttttcctggatcctctgagggagggacgagcccaggcagctcacag
cagggcaggggggacgatgaggcttgcagcatggacaccaactga

DBGET integrated database retrieval system