KEGG   Ailuropoda melanoleuca (giant panda): 100483223Help
Entry
100483223         CDS       T01329                                 

Gene name
USP21
Definition
ubiquitin specific peptidase 21
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 565 aa AA seqDB search
MPQASEHRLGRTREPPVNVQPRVGSKLPFAPRARSKERRNPAPGPNPLLRPLPPRPGPPE
ERLKKLELGRGRTSGPRPRGPLRADHGVPLPGSPPPTVALPLPSRTNLARSKSVSSGDLR
PMGIALGGHRGAGELGAALSRLALRPEPPTLRRSASLRRLGGFPGPPTLLSIRTEPPTSH
GSFHVISARPSESFYSDDKMAHHTLLLGSGHVGLRNLGNTCFLNAVLQCLSSTRPLRDFC
LRRDFRQEVPGGGRAQELTEAFADVIGALWHPDSCEAVNPTRFRAVFQKYVPSFSGYSQQ
DAQEFLKLLMERLHLEINRRGRRAPPILASSAAPCQPRRGGALLEEPDLSDDDRANLMWK
RYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCF
SLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRFSASRGSIKKSSVGV
DFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPV
SENQVASSEGYVLFYQLMQEPPRCL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgccccaggcctctgagcaccgcctgggccgtacccgagagccacctgttaatgtccag
ccccgagtgggatccaagctaccatttgccccgagggcccgaagcaaggagcgacgaaac
ccagcccctgggccgaaccctctgttaagacctctgcctccccggccaggtccccctgag
gaacggctcaagaaactggagctgggacggggacggacctcaggccctcgtcccagagga
ccccttcgggcagatcatggagttcccctgcctggctcaccacccccaactgtggctctg
cctctcccttccaggaccaacctagctcgttccaagtctgtgagcagtggggacttgcgt
cctatggggattgccttgggggggcatcgtggcgctggagagctaggggctgcgctgagc
cgcttggccctccggcctgagcctcccactctgagacgtagcgcctctctccgccgcctc
gggggctttcctggtccccccaccttgctcagtatacggacggagccccctacttcccat
ggctccttccacgtcatatccgcccggccctctgagtctttctactccgatgacaaaatg
gctcatcacacactgcttctgggctccggtcatgttggcctccgaaatctggggaacacg
tgcttcctgaacgcagtgctgcagtgtctgagcagcactcggcctcttcgggacttctgt
ctgcggagggacttccggcaagaggtgcctggagggggtcgagcccaagagctcactgaa
gcctttgcagatgtgattggtgccctgtggcaccctgactcctgtgaagctgtgaatcct
actcgattccgagctgtcttccagaaatacgtcccctccttctctggatacagccagcag
gatgcccaagagtttctgaagctcctcatggagcgcctgcacctcgagatcaaccgccgg
ggccgccgggctccgccgatcctggccagcagtgcagctccgtgtcagccccgccgcgga
ggagctctgctggaagaacctgacttgagtgatgatgaccgagccaacctaatgtggaag
cgttacctggagcgagaagacagcaagattgtggacctgtttgtgggccagttgaaaagt
tgtctcaagtgccaggcctgtgggtatcgctccacgaccttcgaggttttttgtgacctg
tccctgcccatccccaagaaaggatttgccgggggcaaggtgtctctgcgggattgtttc
agccttttcaccaaggaagaagagctagagtcagagaatgctccggtgtgtgaccgatgt
cgacagaaaacacgaagtaccaaaaagttgacagtacagagattcccccgaatcctcgtg
ctccatcttaatcgattttccgcctcccgaggctccatcaagaaaagttcagtaggtgta
gatttcccgctgcagcgactgagcctaggggacttcgccagtgacaaagccggaagcccc
gtctatcagctgtacgccctttgcaaccactcgggcagcgtccactacggccactacaca
gccctgtgccggtgccagactggctggcatgtctacaatgactctcgtgtctcccctgtc
agtgaaaaccaggtggcatccagcgagggctacgtgctgttctaccaactgatgcaggag
ccgccccggtgcctgtga

DBGET integrated database retrieval system