KEGG   Ailuropoda melanoleuca (giant panda): 100483338Help
Entry
100483338         CDS       T01329                                 

Gene name
EIF4E2
Definition
(RefSeq) eukaryotic translation initiation factor 4E family member 2
  KO
K03259  
translation initiation factor 4E
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100483338 (EIF4E2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100483338 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    100483338 (EIF4E2)
   04150 mTOR signaling pathway
    100483338 (EIF4E2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100483338 (EIF4E2)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100483338 (EIF4E2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100483338 (EIF4E2)
Translation factors [BR:aml03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100483338 (EIF4E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 245 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKMERDKSQGSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKP
RLNVP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaagttcgacgcattgaaagatgatgacagtggggaccatgatcagaatgaa
gaaaacagcacacagaaagatggtgagaaggaaaaaatggaacgagacaagagtcagggc
agcagtaagaggaaggctgttgttcctggaccagcagaacatcccctgcagtacaactac
accttctggtactccaggagaacccctggccgtcccaccagctcacagagctatgaacag
aatatcaaacagattggcacctttgcctctgtggagcagttctggaggttttatagccac
atggtacgtcccggggacctgacaggccacagtgacttccatctcttcaaagaaggaatt
aaacccatgtgggaggatgatgcaaataaaaatggtggcaaatggattattcggctgcgg
aagggcttggcatcccgttgctgggagaatcttatcctggccatgttgggggaacagttc
atggttggggaggagatctgtggggctgtggtctctgtccggtttcaggaggacattatt
tcaatatggaataagactgccagtgaccaagcaaccacagcccgaatccgggatacgctt
cggcgagtgcttaacctacctcccaacaccattatggagtacaaaacccacaccgacagc
atcaaaatgccaggcaggctgggcccccaaaggctcctttttcaaaacctctggaagccg
cggttgaatgtgccatga

DBGET integrated database retrieval system