KEGG   Ailuropoda melanoleuca (giant panda): 100483389Help
Entry
100483389         CDS       T01329                                 

Gene name
SIRT6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100483389 (SIRT6)
Enzymes [BR:aml01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100483389 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 359 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELAQLVWQSSNVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECVKCKTQYVRDTVVGSMGLKATGRLCTVAKARGLRACRGE
LRDTILDWEDALPDRDLTLADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPAPKLEPK
EEAPTQLNGPAPASPKPEPSSEPCTQHNGSGPASPKRERLDSPALHRPPKRVKAEVAPS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgcggcgggactgtcgccgtacgcggacaagggcaagtgtggcctc
cccgagatcttcgacccccctgaggagttggagcggaaggtgtgggagctggcgcagctg
gtctggcagtcctccaacgtggtgttccacacgggtgctggcatcagcaccgcctcgggg
atccctgacttcaggggcccccatggtgtctggacgatggaggagcggggcctggccccc
aaatttgacaccaccttcgagagcgcgcggcccacgcagacccacatggcgctggtgcag
ctggagcgcgtgggcctcctccgtttcctggtcagccagaacgtggatgggctgcacgtg
cgctccggtttccccagggacaagctggcggagctccacggaaacatgttcgtagaggag
tgtgtcaagtgtaagacgcagtacgtccgggacaccgtcgtgggcagcatgggcctcaag
gccacgggccggctctgcactgtggccaaggcgagggggctgcgggcctgcaggggggag
ctgagagataccatcctggactgggaggacgccctgcctgaccgggacctcactctcgct
gatgaggccagcaggaacgcagacctgtccatcacactgggcacctccctgcaaatccgg
ccgagcgggaacctgccgcttgccaccaagcgccgaggaggccgactggtcattgtcaac
cttcagcccacgaagcatgaccgccacgctgacctgcgaatccatggctatgtggacgag
gtcatgacccggctcatgaagcacctgggcctggagattcccgcctgggacggcccccgc
gtgctggagagggcgctgccccccctgccccgcccgcccgcgcccaagctggagcccaag
gaggaggcccccacccagctcaatggcccagcacccgccagccccaagccggagccctcc
tcggagccctgcacccagcacaacggctctgggcccgccagccccaagagggagcggctg
gacagtcctgcactgcacaggccccccaaaagggtgaaggccgaggtggcccccagctga

DBGET integrated database retrieval system