KEGG   Ailuropoda melanoleuca (giant panda): 100483500Help
Entry
100483500         CDS       T01329                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycerolipid metabolism
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100483500 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100483500 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    100483500 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    100483500 (MGLL)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100483500 (MGLL)
Peptidases [BR:aml01002]
 Serine Peptidases
  Family S33
   100483500 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 346 aa AA seqDB search
MLPCDGRHEGTALICLALIPRAVVVVECKSQDTMETGLEAPFRMPEESSPRRTPQSVPYQ
DLPHLVNADGQYLFCRFWKPTGTPRALIFVSHGAGEHCGRYDELAQMLAGLGLLVFAHDH
VGHGQSEGERMVVSDFHVFIRDVLQHVDTMQKDYPGLPVFLLGHSMGGAIAILTAAERPS
HFSGMVLISPLVLANPESATTFKVFAAKVLNLVLPNMSLGPIDSSVLSRNKTEVDLYNSD
PLICHAGLKVCFGNQLLNAVTRVERALPKLTLPFLLLQGSADRLCDSKGAYLLMESAKSQ
DKTLKIYEGAYHVLHKELPEVTNSVFREINMWVSQRTGAAGTGSPP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgctgccctgtgacggccgacatgagggaacagcccttatctgcctggctctgatcccc
cgtgctgtcgtggttgtggaatgcaaaagccaggacacgatggaaacaggacttgaagct
cctttcagaatgccggaggaaagttctcccaggcggaccccgcagagcgttccgtaccag
gacctccctcacctggtcaatgcggacggacagtacctgttctgcaggttctggaaaccg
acgggcacacccagggccctcatctttgtgtcccatggagccggggaacactgcggtcgt
tatgacgagctggctcagatgctggcggggctggggctgctggtgttcgcccatgaccat
gttggccatggacagagcgaaggagagaggatggtagtgtctgacttccacgttttcatc
agggacgtgttacagcacgtggataccatgcagaaagactacccagggcttcctgtcttc
cttctgggccactccatgggaggtgccatcgccatcctcacggccgcggagaggccaagc
cacttctccggcatggtcctcatttcgcctttggttcttgccaatcctgagtctgcaaca
actttcaaggtctttgctgcgaaagttctcaaccttgtcctgccaaacatgtccctgggc
ccaattgactccagcgtgctctctcggaataagacagaggtggacctttataactcagac
ccactcatctgccacgcaggtctgaaggtgtgcttcggcaaccagctgctcaacgcggtg
acgcgggtggagcgggccctccccaagctgaccttgcccttcctgctgctccagggctct
gccgaccgcctttgtgacagcaaaggggcctacctgctcatggagtctgccaagagccag
gacaagacactcaagatttacgaaggtgcctaccacgttctccacaaagagcttcctgaa
gtaaccaactcggtcttccgtgaaataaacatgtgggtctcccaaaggacaggggcggca
ggaacagggtccccaccctga

DBGET integrated database retrieval system