KEGG   Ailuropoda melanoleuca (giant panda): 100483652Help
Entry
100483652         CDS       T01329                                 

Definition
pyruvate dehydrogenase [lipoamide] kinase isozyme 1-like
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
HIF-1 signaling pathway
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100483652
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100483652
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100483652
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100483652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 578 aa AA seqDB search
MNASKEEVLPAIGKVRGLSWQHSTRSRIKPARPKMPEFPAGKNVISSQVQETSGYFGDLE
KRNSPKSTVEQKRYPFSGNHTLNFDLSPSNVKSVESFWNALGLAAAHRCGKRSAAQSLSV
LLRLGRHRKQEGVVLSERAWEGGAPEGERGLAAPAPPPPAGFPAAPRGGAGLARDCGDLP
ESGVPGQVDFYARFSPSPLSMKQFLDFGSMNACEKTSFMFLRQELPVRLANIMKEISLLP
DNLLRTPSVQLVQSWYFQSLQELLEFKDKSAEDAKTIYDFTDTVIRIRNRHNDVIPTMAQ
GVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPAHRKHIGS
INPNCNVVEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVF
ELFKNAMRATMEHHADKGVYPPIQVHITLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYST
APRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTESIE
RLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccagcaaagaggaagtcttgccagctatcgggaaagtcagaggcctgtcctgg
cagcactccacaagaagccggatcaaaccagccaggcccaagatgccagagttcccagca
ggaaagaatgtcatttcctcacaggtgcaggaaacctcagggtattttggcgacctcgag
aagaggaattcacccaaatctacagtggagcaaaagcgatacccattcagtggaaatcat
accttgaattttgatctttccccaagcaacgtaaaaagtgtggagagtttctggaacgcg
ctcggtctcgcagcagcacaccgttgtgggaagcggagcgcggcccagtccttgagcgtt
ttgctgaggctggggaggcacagaaagcaggaaggtgtggttctctccgaaagagcgtgg
gaagggggcgcgccagaaggcgagcgcggcttagcagccccggcgccgccgccacctgcg
ggcttcccagctgcgccgcggggcggggcggggctggcccgggactgcggagacttgcct
gagagcggcgttccgggccaggtggacttctacgcgcgcttctcgccgtccccgctttcc
atgaagcagttcctggacttcggatctatgaatgcttgtgaaaaaacctcatttatgttt
ctgcggcaagagctgcctgttagattggcaaatataatgaaagaaataagtcttctccca
gataatcttctcaggactccatcagttcaattggtacaaagctggtatttccagagtctt
caggagcttcttgaatttaaagacaaaagtgccgaagatgctaaaactatttatgacttt
acagatactgtgattcggatcaggaaccgacacaacgatgtcattcccacgatggcccag
ggtgtgattgaatataaggagagcttcggggtggaccctgtcaccagccagaatgttcag
tactttttggatcgtttctacatgagtcgcatttcaattagaatgttactcaatcagcac
tctttattgtttggtggaaaaggcaaaggaagcccagctcatcgaaaacacattggaagc
ataaatccaaactgcaatgtagttgaagttattaaagatggctatgaaaatgctaggcgt
ctgtgtgatttgtattatattaactctcctgaactagaacttgaagaactaaatgcaaaa
tcaccaggacagccaatacaagtggtttatgtaccatcccatctctatcacatggtgttt
gaacttttcaagaatgcaatgagagcaacgatggaacaccatgctgacaaaggtgtttac
cctcctattcaagtccacatcacactgggtaatgaggatttgactgtgaagatgagtgac
cgaggaggtggggttcctttgaggaaaattgacagactcttcaactacatgtactcaact
gcaccccggcctcgtgttgagacgtcccgagcagtgcctctggctggttttggttatgga
ttgcccatatcacgtctttatgcccaatatttccaaggagacctaaagctatattctcta
gaaggttatgggacagatgcggtcatctacattaaggctctgtcaacggaatcgatagag
agactcccagtgtataacaaagctgcctggaagcattacaacaccaaccatgaggctgat
gactggtgtgtccccagcagggaaccaaaagacatgacaacgtttcgcagtgcctag

DBGET integrated database retrieval system