KEGG   Ailuropoda melanoleuca (giant panda): 100483848Help
Entry
100483848         CDS       T01329                                 

Gene name
C1GALT1
Definition
(RefSeq) core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
  KO
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100483848 (C1GALT1)
Enzymes [BR:aml01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     100483848 (C1GALT1)
Glycosyltransferases [BR:aml01003]
 Glycan extension
  Type 3 chain
   100483848 (C1GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 367 aa AA seqDB search
MSEIRFREMASKSWLNFLTFLCGSAIGFVLCSQLFSILLGEQGDTQPNILHNDPHARHSD
DNGQNHLEGQMNFNADSSQHTDENTDIAENLYQKVKILCWVMTGPQNLEKKAKHVKATWA
QRCNKVLFMSSEENKDFPAVGLKTREGRDQLYWKTIKAFQYVHDHYLEDADWFMKADDDT
YVILDNLRWLLSKYNPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKC
THSSSIEDLALGRCMEIINVEAGDSRDTTGKETFHPFVPEHHLIKGYLPRTFWYWNYNYY
PPVEGPGCCSDLAVSFHYVDPTTMYELEYLVYHLRPYGYLYRYQPALPENILKEISRSYK
NEEPKVK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaatacgctttcgggaaatggcctctaaatcttggctgaattttttaaccttc
ctttgtggatcagcaattggatttgttttatgttctcagctatttagtattttgttggga
gaacagggtgatacccagcctaatattcttcataatgatcctcatgctaggcattcagat
gataatggacaaaatcatctagaaggacagatgaacttcaatgcagattctagccaacat
acagatgagaacacagacatcgctgaaaatctctatcaaaaggttaaaattctttgctgg
gttatgacagggcctcaaaatctagagaaaaaggccaaacacgtcaaagctacatgggcg
cagcgttgtaataaagtgttgtttatgagttcagaagaaaataaagacttccctgctgtg
ggattaaaaaccagagaaggcagagaccaactatactggaaaacaattaaagcttttcag
tatgttcatgatcattatttagaagatgctgattggtttatgaaagcagatgatgataca
tatgttatactggataatttgagatggcttctctcaaaatacaaccctgaggaacccatt
tacttcgggagaagatttaagccctatgtaaagcagggctacatgagtggaggagcagga
tatgtactgagcaaagaagccctgaagagatttgttgatgcatttaaaacagacaaatgt
acacatagttcctccatcgaagacttagcattgggcagatgcatggaaattataaatgta
gaagcaggagattcccgagataccactggaaaagaaacttttcatccctttgtaccagaa
caccacttaatcaagggttatctacctagaaccttttggtactggaattataactattat
cctcctgtagagggtcctggttgctgttctgatcttgcagtttcttttcactatgttgat
cctacaactatgtatgagttagaatacctcgtttatcatcttcgtccatatggttattta
tacagatatcaacctgccttacctgaaaatatactaaaagaaataagtcgatcatacaaa
aatgaagagccaaaagtaaaatga

DBGET integrated database retrieval system